Tested Applications
| Positive WB detected in | mouse pancreas tissue, rat pancreas tissue |
| Positive IHC detected in | human pancreas tissue, human heart tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | A431 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below |
| WB | See 10 publications below |
| IHC | See 2 publications below |
| IF | See 1 publications below |
Product Information
21391-1-AP targets ALDH1L2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, pig |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag16046 Product name: Recombinant human ALDH1L2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-103 aa of BC103935 Sequence: MVTFYGSTLLNSSVPPGEPLEIKGAKKPGLVTKNGLVLFGNDGKALTVRNLQFEDGKMIPASQYFSTGETSVVELTAEEVKVAETIKVIWAGILSNVPIIEDS Predict reactive species |
| Full Name | aldehyde dehydrogenase 1 family, member L2 |
| Calculated Molecular Weight | 923 aa, 102 kDa |
| Observed Molecular Weight | 102 kDa, 89 kDa |
| GenBank Accession Number | BC103935 |
| Gene Symbol | ALDH1L2 |
| Gene ID (NCBI) | 160428 |
| RRID | AB_2878854 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q3SY69 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ALDH1L2(Aldehyde dehydrogenase family 1 member L2) is also named as mitochondrial 10-FTHFDH, mtFDH and belongs to the aldehyde dehydrogenase family and ALDH1L subfamily. The ALDH1L2 gene has three transcriptional variants with the molecular weight of 102 kDa, 42 kDa and 89 kDa(PMID:19823103). It is a mitochondrial enzyme, a likely source of CO2 production from 10-formyltetrahydrofolate in mitochondria and playing an essential role in the distribution of one-carbon groups between the cytosolic and mitochondrial compartments of the cell(PMID: 20498374). It also has dehydrogenase/hydrolase activities similar to cytosolic FDH (ALDH1L1). The native ALDH1L2 has been reported to exist as a dimer or tetramer(PMID:7822273).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for ALDH1L2 antibody 21391-1-AP | Download protocol |
| IHC protocol for ALDH1L2 antibody 21391-1-AP | Download protocol |
| WB protocol for ALDH1L2 antibody 21391-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Sci Adv G6PD-mediated increase in de novo NADP+ biosynthesis promotes antioxidant defense and tumor metastasis. | ||
Nat Commun Defective NADPH production in mitochondrial disease complex I causes inflammation and cell death. | ||
Mol Metab Maternal hyperglycemia induces alterations in hepatic amino acid, glucose and lipid metabolism of neonatal offspring: Multi-omics insights from a diabetic pig model | ||
Free Radic Biol Med Ursodeoxycholic acid protects against cisplatin-induced acute kidney injury and mitochondrial dysfunction through acting on ALDH1L2. | ||
J Biol Chem Acetylation of aldehyde dehydrogenase ALDH1L2 regulates cellular redox balance and the chemosensitivity of colorectal cancer to 5-Fluorouracil |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Gwenaelle (Verified Customer) (02-10-2026) | l'anticorps anti ALDH1L2 a été testé en western blot au 1/1000 puis au 1/500 sur des extraits protéiques dosés ( dépôt 30 et 40µg/puits) de cellules HeLa. L'anticorps est sale et on observe plusieurs bandes allant de 40 à 100kDa (taille calculée 102kDa, taille observée 89kDa selon la fiche technique).
|
FH Hua (Verified Customer) (08-26-2019) | Works well.
![]() |














