• Featured Product
  • KD/KO Validated

ALDH1L2 Polyclonal antibody

ALDH1L2 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 21391-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, ELISA

ALDH1L 2, EC:1.5.1.6, Mitochondrial 10-formyltetrahydrofolate dehydrogenase, Mitochondrial 10-FTHFDH, mtFDH

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse pancreas tissue, rat pancreas tissue
Positive IHC detected inhuman pancreas tissue, human heart tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inA431 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:3000
Immunohistochemistry (IHC)IHC : 1:20-1:200
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

21391-1-AP targets ALDH1L2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, pig
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag16046

Product name: Recombinant human ALDH1L2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-103 aa of BC103935

Sequence: MVTFYGSTLLNSSVPPGEPLEIKGAKKPGLVTKNGLVLFGNDGKALTVRNLQFEDGKMIPASQYFSTGETSVVELTAEEVKVAETIKVIWAGILSNVPIIEDS

Predict reactive species
Full Name aldehyde dehydrogenase 1 family, member L2
Calculated Molecular Weight 923 aa, 102 kDa
Observed Molecular Weight 102 kDa, 89 kDa
GenBank Accession NumberBC103935
Gene Symbol ALDH1L2
Gene ID (NCBI) 160428
RRIDAB_2878854
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ3SY69
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ALDH1L2(Aldehyde dehydrogenase family 1 member L2) is also named as mitochondrial 10-FTHFDH, mtFDH and belongs to the aldehyde dehydrogenase family and ALDH1L subfamily. The ALDH1L2 gene has three transcriptional variants with the molecular weight of 102 kDa, 42 kDa and 89 kDa(PMID:19823103). It is a mitochondrial enzyme, a likely source of CO2 production from 10-formyltetrahydrofolate in mitochondria and playing an essential role in the distribution of one-carbon groups between the cytosolic and mitochondrial compartments of the cell(PMID: 20498374). It also has dehydrogenase/hydrolase activities similar to cytosolic FDH (ALDH1L1). The native ALDH1L2 has been reported to exist as a dimer or tetramer(PMID:7822273).

Protocols

Product Specific Protocols
IF protocol for ALDH1L2 antibody 21391-1-APDownload protocol
IHC protocol for ALDH1L2 antibody 21391-1-APDownload protocol
WB protocol for ALDH1L2 antibody 21391-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

Mol Cell

Kynurenine importation by SLC7A11 propagates anti-ferroptotic signaling.

Authors - Alessandra Fiore
humanIHC

Sci Adv

G6PD-mediated increase in de novo NADP+ biosynthesis promotes antioxidant defense and tumor metastasis.

Authors - Yang Zhang
humanWB

Nat Commun

Defective NADPH production in mitochondrial disease complex I causes inflammation and cell death.

Authors - Eduardo Balsa
pigWB

Mol Metab

Maternal hyperglycemia induces alterations in hepatic amino acid, glucose and lipid metabolism of neonatal offspring: Multi-omics insights from a diabetic pig model

Authors - Bachuki Shashikadze
mouse,humanWB,IHC

Free Radic Biol Med

Ursodeoxycholic acid protects against cisplatin-induced acute kidney injury and mitochondrial dysfunction through acting on ALDH1L2.

Authors - Yunwen Yang
humanWB

J Biol Chem

Acetylation of aldehyde dehydrogenase ALDH1L2 regulates cellular redox balance and the chemosensitivity of colorectal cancer to 5-Fluorouracil

Authors - Chaoqun Li

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Gwenaelle (Verified Customer) (02-10-2026)

l'anticorps anti ALDH1L2 a été testé en western blot au 1/1000 puis au 1/500 sur des extraits protéiques dosés ( dépôt 30 et 40µg/puits) de cellules HeLa. L'anticorps est sale et on observe plusieurs bandes allant de 40 à 100kDa (taille calculée 102kDa, taille observée 89kDa selon la fiche technique).

  • Applications: Western Blot
  • Primary Antibody Dilution: 1/1000 et 1/500
  • Cell Tissue Type: HELA
FH

Hua (Verified Customer) (08-26-2019)

Works well.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: liver, kidney, hippocampus
ALDH1L2 Antibody Western Blot, validation (1:1000 dilution) in liver, kidney, hippocampus (Cat no:21391-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...