Tested Applications
| Positive WB detected in | mouse heart tissue, mouse kidney tissue, HEK-293 cells, rat heart tissue |
| Positive IP detected in | mouse heart tissue |
| Positive IHC detected in | human kidney tissue, human oesophagus cancer tissue, human heart tissue, human ovary tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | NIH/3T3 cells, HT-29 cells, HEK-293 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
18374-1-AP targets ANGPTL4 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag13237 Product name: Recombinant human ANGPTL4 protein Source: e coli.-derived, PKG Tag: GST Domain: 1-374 aa of BC023647 Sequence: MSGAPTAGAALMLCAATAVLLSAQGGPVQSKSPRFASWDEMNVLAHGLLQLGQGLREHAERTRSQLSALERRLSACGSACQGTEGSTDLPLAPESRVDPEVLHSLQTQLKAQNSRIQQLFHKVAQQQRHLEKQHLRIQHLQSQFGLLDHKHLDHEVAKPARRKRLPEMAQPVDPAHNVSRLHRLPRDCQELFQVGERQSGLFEIQPQGSPPFLVNCKMTSDGGWTVIQRRHDGSVDFNRPWEAYKAGFGDPHGEFWLGLEKVHSITGDRNSRLAVQLRDWDGNAELLQFSVHLGGEDTAYSLQLTAPVAGQLGATTVPPSGLSVPFSTWDQDHDLRRDKNCAKSLSGGWWFGTCSHSNLNGQYFRSIPQQRQKL Predict reactive species |
| Full Name | angiopoietin-like 4 |
| Calculated Molecular Weight | 45 kDa |
| Observed Molecular Weight | 45-50 kDa |
| GenBank Accession Number | BC023647 |
| Gene Symbol | ANGPTL4 |
| Gene ID (NCBI) | 51129 |
| RRID | AB_2878539 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9BY76 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Angiopoietin-like protein 4 (ANGPTL4), a member of the angiopoietin-like protein subfamily, is a secretory protein that functions as an important modulator of glucose and lipid metabolism. ANGPTL4 inhibits lipoprotein lipase (LPL)-dependent lipolysis thereby limiting the uptake of free fatty acids. Overexpression of ANGPTL4 results in hypertriglyceridemia, while ANGPTL4 deficiency suppresses foam formation in macrophages and protects against atherosclerosis. ANGPTL4 may play a role in several cancers and it also has been shown to prevent the metastatic process by inhibiting vascular activity as well as tumor cell motility and invasiveness. Decreased expression of this protein has been associated with type 2 diabetes. ANGPTL4 has three isoforms, 45 kDa, 41 kDa and 27 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for ANGPTL4 antibody 18374-1-AP | Download protocol |
| IHC protocol for ANGPTL4 antibody 18374-1-AP | Download protocol |
| IP protocol for ANGPTL4 antibody 18374-1-AP | Download protocol |
| WB protocol for ANGPTL4 antibody 18374-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The ANGPTL4 antibody (Cat# 18374-1-AP) has accumulated 63 citations published in high-impact journals including Cancer Cell, Nature Metabolism, Molecular Cancer, Journal of Clinical Investigation, EMBO Journal, FASEB Journal, and Advanced Science. Associated research fields span oncology (pancreatic, prostate, lung, breast, melanoma), fibrosis (renal, pulmonary, hepatic), cardiovascular disease, metabolic disorders (obesity, diabetes), neurodegeneration, reproductive biology, bone/joint pathology, and environmental toxicology.
| Species | Application | Title |
|---|---|---|
Cancer Cell Mapping cell type-resolved transcriptomic profiles to patient survival in pancreatic cancer. | ||
Mol Cancer Targeting OxLDL-mediated CD36 + CAF reprogramming potentiates PD-1 immunotherapy in osteosarcoma | ||
Nat Metab Resistant starch intake facilitates weight loss in humans by reshaping the gut microbiota | ||
Cancer Res Retrodifferentiation of human tumor hepatocytes to stem cells leads to metabolic reprogramming and chemoresistance. | ||
J Adv Res Gestational exposure to PM(2.5) impaired cardiac development through ANGPTL4-mediated mitochondrial metabolic dysfunction.
| ||
J Adv Res Maternal exposure to urban particulate matter induces cardiac developmental toxicity in zebrafish offspring by disrupting mitochondrial homeostasis |
Reviews
What customers say
The single review for this product is highly positive. A user named Niklas Hartmann rated it 5 out of 5 stars after using it for immunofluorescence on human fibroblasts at a 1:350 dilution. He described the result as "bright and specific staining," indicating strong performance with clear signal and minimal background. Overall, the feedback suggests reliable specificity and intensity for IF applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Niklas (Verified Customer) (11-28-2022) | bright and specific staining
|

































