Tested Applications
Positive WB detected in | Jurkat cells, A375 cells, A549 cells, mouse brain tissue, rat skeletal muscle tissue |
Positive IP detected in | mouse brain tissue |
Positive IHC detected in | human gliomas tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | A375 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:10-1:100 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 2 publications below |
WB | See 7 publications below |
IHC | See 1 publications below |
IP | See 1 publications below |
Product Information
11678-1-AP targets ARPP-19 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag2279 Product name: Recombinant human ARPP-19 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-112 aa of BC003418 Sequence: MSAEVPEAASAEEQKEMEDKVTSPEKAEEAKLKARYPHLGQKPGGSDFLRKRLQKGQKYFDSGDYNMAKAKMKNKQLPTAAPDKTEVTGDHIPTPQDLPQRKPSLVASKLAG Predict reactive species |
Full Name | cyclic AMP phosphoprotein, 19 kD |
Calculated Molecular Weight | 19 kDa |
Observed Molecular Weight | 19 kDa |
GenBank Accession Number | BC003418 |
Gene Symbol | ARPP-19 |
Gene ID (NCBI) | 10776 |
RRID | AB_2060078 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P56211 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ARPP-19, a 19-kDa cAMP-regulated phosphoprotein, plays a role in regulating mitosis. Initiation and maintenance of mitosis require the activation of protein kinase cyclin B-Cdc2 and the inhibition of protein phosphatase 2A (PP2A). When phosphorylated by protein kinase Greatwall (Gwl), ARPP-19 associate with and inhibit PP2A, thus promoting mitotic entry. ARPP-19 may be an important link between nerve growth factor (NGF) signaling and post-transcriptional control of neuronal gene expression such as GAP-43.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for ARPP-19 antibody 11678-1-AP | Download protocol |
IHC protocol for ARPP-19 antibody 11678-1-AP | Download protocol |
IF protocol for ARPP-19 antibody 11678-1-AP | Download protocol |
IP protocol for ARPP-19 antibody 11678-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Front Oncol Identification of Glycolysis-Related lncRNAs and the Novel lncRNA WAC-AS1 Promotes Glycolysis and Tumor Progression in Hepatocellular Carcinoma. | ||
J Proteome Res Phosphoproteome Profiling Revealed the Importance of mTOR Inhibition on CDK1 Activation to Further Regulate Cell Cycle Progression. | ||
Cancers (Basel) Arpp19 Promotes Myc and Cip2a Expression and Associates with Patient Relapse in Acute Myeloid Leukemia.
| ||
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Iram (Verified Customer) (01-15-2021) | ARPP19 antibody giving a very clear sharp bands
|