Filter: AllWBIHC

WB analysis of MCF-7 using 17725-1-AP
MCF7 cells were subjected to SDS PAGE followed by western blot with 17725-1-AP (ATP6V1F antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
WB analysis of HeLa using 17725-1-AP
HeLa cells were subjected to SDS PAGE followed by western blot with 17725-1-AP (ATP6V1F antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
WB analysis of Jurkat using 17725-1-AP
Jurkat cells were subjected to SDS PAGE followed by western blot with 17725-1-AP (ATP6V1F antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
WB analysis of mouse skeletal muscle using 17725-1-AP
mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 17725-1-AP (ATP6V1F antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
WB analysis of mouse liver using 17725-1-AP
mouse liver tissue were subjected to SDS PAGE followed by western blot with 17725-1-AP (ATP6V1F antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
IHC staining of human testis using 17725-1-AP
Immunohistochemical analysis of paraffin-embedded human testis using 17725-1-AP (ATP6V1F antibody) at dilution of 1:50 (under 10x lens).
IHC staining of human testis using 17725-1-AP
Immunohistochemical analysis of paraffin-embedded human testis using 17725-1-AP (ATP6V1F antibody) at dilution of 1:50 (under 40x lens).
IHC staining of human brain using 17725-1-AP
Immunohistochemical analysis of paraffin-embedded human brain using 17725-1-AP (ATP6V1F antibody) at dilution of 1:50 (under 10x lens).
IHC staining of human brain using 17725-1-AP
Immunohistochemical analysis of paraffin-embedded human brain using 17725-1-AP (ATP6V1F antibody) at dilution of 1:50 (under 40x lens).
IHC staining of human pancreas using 17725-1-AP
Immunohistochemical analysis of paraffin-embedded human pancreas tissue slide using 17725-1-AP (ATP6V1F Antibody) at dilution of 1:50 (under 10x lens).
IHC staining of human pancreas using 17725-1-AP
Immunohistochemical analysis of paraffin-embedded human pancreas tissue slide using 17725-1-AP (ATP6V1F Antibody) at dilution of 1:50 (under 40x lens).
IHC staining of human kidney using 17725-1-AP
Immunohistochemical analysis of paraffin-embedded human kidney using 17725-1-AP (ATP6V1F antibody) at dilution of 1:50 (under 10x lens).
IHC staining of human kidney using 17725-1-AP
Immunohistochemical analysis of paraffin-embedded human kidney using 17725-1-AP (ATP6V1F antibody) at dilution of 1:50 (under 40x lens).
IHC staining of human placenta using 17725-1-AP
Immunohistochemical analysis of paraffin-embedded human placenta using 17725-1-AP (ATP6V1F antibody) at dilution of 1:50 (under 10x lens).
IHC staining of human placenta using 17725-1-AP
Immunohistochemical analysis of paraffin-embedded human placenta using 17725-1-AP (ATP6V1F antibody) at dilution of 1:50 (under 40x lens).

ATP6V1F Polyclonal antibody

Name: ATP6V1F Polyclonal antibody
Brand: Proteintech
SKU: 17725-1-AP

ATP6V1F Polyclonal Antibody for WB, IHC, ELISA

Cat No. 17725-1-AP

Publications(4)

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, CoIP, ELISA

Synonyms

ATP6S14, ATP6V1F, V ATPase 14 kDa subunit, V ATPase subunit F, V type proton ATPase subunit F, Vacuolar proton pump subunit F, VATF, Vma7

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information
Publications (4)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	MCF7 cells, HeLa cells, Jurkat cells, mouse liver tissue, mouse skeletal muscle tissue
Positive IHC detected in	human testis tissue, human brain tissue, human kidney tissue, human pancreas tissue, human placenta tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:500-1:2000
Immunohistochemistry (IHC)	IHC : 1:20-1:200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WB	See 4 publications below
IHC	See 1 publications below
CoIP	See 1 publications below

Product Information

17725-1-AP targets ATP6V1F in WB, IHC, CoIP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity	human, mouse
Cited Reactivity	human, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag12121 Product name: Recombinant human ATP6V1F protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-119 aa of BC107854 Sequence: MAGRGKLIAVIGDEDTVTGFLLGGIGELNKNRHPNFLVVEKDTTINEIEDTFRQFLNRDDIGIILINQYIAEMVRHALDAHQQSIPAVLEIPSKEHPYDAAKDSILRRARGMFTAEDLR Predict reactive species
Full Name	ATPase, H+ transporting, lysosomal 14kDa, V1 subunit F
Calculated Molecular Weight	119 aa, 13 kDa
Observed Molecular Weight	14 kDa
GenBank Accession Number	BC107854
Gene Symbol	ATP6V1F
Gene ID (NCBI)	9296
RRID	AB_2062680
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q16864
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ATP6V1F(V-type proton ATPase subunit F) is also named as ATP6S14, VATF and belongs to the V-ATPase F subunit family. It generates an electrochemical proton gradient that is acid and positive inside synaptic vesicles. ATP6V1F plays a major role as energizers of animal plasma membranes, especially apical plasma membranes of epithelial cells. This protein has 2 isoforms produced by alternative splicing with the molecular weight of 14 kDa and 16 kDa.

Protocols

Product Specific Protocols
FC protocol for ATP6V1F antibody 17725-1-AP	Download protocol
IHC protocol for ATP6V1F antibody 17725-1-AP	Download protocol
WB protocol for ATP6V1F antibody 17725-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

Species	Application	Title
rat	WB	J Trace Elem Med Biol Study on the mechanism of arsenic-induced renal injury based on SWATH proteomics technology Authors - Xiaolu Chen View Article
human	IHC,WB	BMC Med Genomics ATP6V1F is a novel prognostic biomarker and potential immunotherapy target for hepatocellular carcinoma Authors - Xinyao Hu View Article
human	WB,CoIP	J Proteome Res Proteomic Investigation of Differential Interactomes of Glypican 1 and a Putative Disease-Modifying Variant of Ataxia Authors - Nur Cengiz Winter View Article
human	WB	Front Oncol Genome-wide association studies identify miRNA-194 as a prognostic biomarker for gastrointestinal cancer by targeting ATP6V1F, PPP1R14B, BTF3L4 and SLC7A5 Authors - Pan Huang View Article