Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

C20orf20 Polyclonal antibody

C20orf20 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, IP, ELISA

Eaf7, MRG/MORF4L-binding protein, MRG15BP, MRG-binding protein, MRGBP

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for C20orf20 in ?

Tested Applications

Positive WB detected inHepG2 cells, mouse testis tissue
Positive IP detected inHepG2 cells
Positive IHC detected inhuman colon cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

26040-1-AP targets C20orf20 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag22840

Product name: Recombinant human C20orf20 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-204 aa of BC014235

Sequence: MGEAEVGGGGAAGDKGPGEAATSPAEETVVWSPEVEVCLFHAMLGHKPVGVNRHFHMICIRDKFSQNIGRQVPSKVIWDHLSTMYDMQALHESEILPFPNPERNFVLPEEIIQEVREGKVMIEEEMKEEMKEDVDPHNGADDVFSSSGSLGKASEKSSKDKEKNSSDLGCKEGADKRKRSRVTDKVLTANSNPSSPSAAKRRRT

Predict reactive species
Full Name chromosome 20 open reading frame 20
Calculated Molecular Weight 204 aa, 22 kDa
Observed Molecular Weight 30 kDa
GenBank Accession NumberBC014235
Gene Symbol C20orf20
Gene ID (NCBI) 55257
RRIDAB_2880347
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9NV56
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

C20orf20, also named as MRG/MORF4L-binding protein or Up-regulated in colon cancer 4 (Urcc4), is a 204 amino acid protein, which belongs to the EAF7 family. C20orf20 localizes in the nucleus and is a Component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. C20orf20 is modified through phosphorylation and acetylation, so the molecular weight of C20orf20 might be 25-30 kDa.

Protocols

Product Specific Protocols
IF protocol for C20orf20 antibody 26040-1-APDownload protocol
IHC protocol for C20orf20 antibody 26040-1-APDownload protocol
IP protocol for C20orf20 antibody 26040-1-APDownload protocol
WB protocol for C20orf20 antibody 26040-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The C20orf20 Polyclonal antibody (Cat# 26040-1-AP) has 3 total citations. These appear in Nature, Journal of Cellular and Molecular Medicine, and Biochimica et Biophysica Acta. The research fields span glioblastoma epigenetic reprogramming, glioma pathway-based stratification and tumor microenvironment characterization, and prostate cancer transcriptional regulation via histone acetylation. All citations used human samples with WB or IHC applications.

SpeciesApplicationTitle
humanWB

Nature

BRD8 maintains glioblastoma by epigenetic reprogramming of the p53 network

Authors - Xueqin Sun
humanIHC

J Cell Mol Med

Pathway-based stratification of gliomas uncovers four subtypes with different TME characteristics and prognosis

Authors - Ruoyu Huang
humanWB

Biochim Biophys Acta

MRGBP promotes AR-mediated transactivation of KLK3 and TMPRSS2 via acetylation of histone H2A.Z in prostate cancer cells.

Authors - Saya Ito
  • KD Validated
Loading...
||
New chat

Able™

正在加载,请稍候...