• Featured Product
  • KD/KO Validated

Caspase 1/P20 Polyclonal antibody

Caspase 1/P20 Polyclonal Antibody for WB, IHC, IF, ELISA
Cat No. 22915-1-AP
Publications(1043)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (7)

Applications

WB, IHC, IF, IP, ELISA

CASP1, Caspase1, CASP 1, CASP-1, Caspase 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inRaji cells, HepG2 cells, Jurkat cells, THP-1 cells, U-937 cells, PC-12 cells
Positive IHC detected inhuman spleen tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF detected in

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:12000
Immunohistochemistry (IHC)IHC : 1:100-1:400
Immunofluorescence (IF)IF : 1:10-1:100
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

22915-1-AP targets Caspase 1/P20 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, pig, rabbit, canine, monkey, chicken, hamster, duck
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag11143

Product name: Recombinant human Caspase 1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-311 aa of BC062327

Sequence: MADKVLKEKRKLFIRSMGEAPQAVQDNPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKDSVGVSGNLSLPTTEEFEDDAIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH

Predict reactive species
Full Name caspase 1, apoptosis-related cysteine peptidase (interleukin 1, beta, convertase)
Calculated Molecular Weight 404 aa, 45 kDa
Observed Molecular Weight 45-47 kDa, 30 kDa, 35 kDa
GenBank Accession NumberBC062327
Gene Symbol Caspase 1
Gene ID (NCBI) 834
RRIDAB_2876874
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP29466
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CASP1(caspase-1) is also named as IL1BC, IL1BCE and belongs to the peptidase C14A family. It is a cysteine protease that regulates inflammatory processes through its capacity to process and activate the interleukin-1-beta (IL1B), IL18, and IL33 precursor proteins. The active caspase-1 can increase cellular membrane permeability and intracellular calcium levels, which facilitates lysosome exocytosis and release of host antimicrobial factors and microbial products (PMID:21804020). It has 5 isoforms produced by alternative splicing. 22915-1-AP can recognize p45 procaspase and the mature fragment p20.

Protocols

Product Specific Protocols
IHC protocol for Caspase 1/P20 antibody 22915-1-APDownload protocol
WB protocol for Caspase 1/P20 antibody 22915-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Cell Res

Signal-induced NLRP3 phase separation initiates inflammasome activation

Authors - Gonglu Zou
WB

Mol Cancer

Metal-enriched HSP90 nanoinhibitor overcomes heat resistance in hyperthermic intraperitoneal chemotherapy used for peritoneal metastases

Authors - Qiang Wang
humanWB

ACS Nano

Engineering Extracellular Vesicles Restore the Impaired Cellular Uptake and Attenuate Intervertebral Disc Degeneration.

Authors - Zhiwei Liao
WB,IF

Mol Cell

Serine synthesis sustains macrophage IL-1β production via NAD+-dependent protein acetylation

Authors - Chuanlong Wang
humanWB

J Hazard Mater

Adverse outcome pathway-based approach to reveal the mechanisms of skin sensitization and long-term aging effects of chlorothalonil

Authors - Yung-Hsuan Cheng
IHC

J Hazard Mater

Perinatal exposure to PBEB aggravates liver injury via macrophage-derived TWEAK in male adult offspring mice under western diet

Authors - Wanyue Wang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Anne (Verified Customer) (04-01-2025)

It worked well in the Western Blot experiment.

  • Applications: Western Blot
FH

Anne (Verified Customer) (01-31-2025)

It worked well in the Western Blot experiment.

  • Applications: Western Blot
FH

Joseph (Verified Customer) (02-19-2020)

This antibody detected pro-caspase 1 and the p20 cleaved product in PDAC cell lines. I did not look for the p10 cleaved product.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: PDAC cell lines
FH

Tanusree (Verified Customer) (12-03-2019)

This antibody works good in western blotting analysis using mouse tissues.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: Mouse brain
Loading...
||
New chat Able
正在加载,请稍候...