Tested Applications
| Positive WB detected in | mouse liver tissue, mouse heart tissue |
| Positive IP detected in | mouse liver tissue |
| Positive IHC detected in | human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 4 publications below |
| WB | See 22 publications below |
| IF | See 1 publications below |
Product Information
15083-1-AP targets COQ7 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag7161 Product name: Recombinant human COQ7 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-217 aa of BC003185 Sequence: MSCAGAAAAPRLWRLRPGARRSLSAYGRRTSVRFRSSGMTLDNISRAAVDRIIRVDHAGEYGANRIYAGQMAVLGRTSVGPVIQKMWDQEKDHLKKFNELMVTFRVRPTVLMPLWNVLGFALGAGTALLGKEGAMACTVAVEESIAHHYNNQIRTLMEEDPEKYEELLQLIKKFRDEELEHHDIGLDHDAELAPAYAVLKSIIQAGCRVAIYLSERL Predict reactive species |
| Full Name | coenzyme Q7 homolog, ubiquinone (yeast) |
| Calculated Molecular Weight | 24 kDa |
| Observed Molecular Weight | 20~24 kDa |
| GenBank Accession Number | BC003185 |
| Gene Symbol | COQ7 |
| Gene ID (NCBI) | 10229 |
| RRID | AB_2082207 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q99807 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
COQ7(Ubiquinone biosynthesis protein COQ7 homolog) catalyzes the production of coenzyme Q (CoQ) in mitochondria. The predicted protein contains 179 amino acids, is mostly helical, and contains an alpha-helical membrane insertion. It has a potential N-glycosylation site, a phosphorylation site for protein kinase C and another for casein kinase II, and 3 N-myristoylation sites. This protein has 2 isoforms produced by alternative splicing with MW 20-24 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for COQ7 antibody 15083-1-AP | Download protocol |
| IP protocol for COQ7 antibody 15083-1-AP | Download protocol |
| WB protocol for COQ7 antibody 15083-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nat Cell Biol A nuclear role for the respiratory enzyme CLK-1 in regulating mitochondrial stress responses and longevity. | ||
J Clin Invest ADCK4 mutations promote steroid-resistant nephrotic syndrome through CoQ10 biosynthesis disruption.
| ||
EMBO Mol Med β-RA reduces DMQ/CoQ ratio and rescues the encephalopathic phenotype in Coq9 R239X mice. | ||
Redox Biol The Q-junction and the inflammatory response are critical pathological and therapeutic factors in CoQ deficiency. | ||
Acta Pharmacol Sin Dysregulation of iron homeostasis and methamphetamine reward behaviors in Clk1-deficient mice. |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Ying (Verified Customer) (04-26-2021) | It's super clean and works great.
|











