Tested Applications
| Positive WB detected in | mouse kidney tissue, HEK-293 cells, mouse liver tissue, mouse kidney, rat kidney | 
| Positive IHC detected in | human skin cancer tissue, human gliomas tissue,  rat kidney tissue,  human urothelial carcinoma tissue,  mouse lung tissue,  mouse kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0  | 
| Positive IF/ICC detected in | HepG2 cells, HeLa cells | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 | 
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 | 
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below | 
| WB | See 21 publications below | 
| IHC | See 6 publications below | 
| IF | See 9 publications below | 
| IP | See 1 publications below | 
| CoIP | See 1 publications below | 
Product Information
12497-1-AP targets TORC2 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat | 
| Cited Reactivity | human, mouse, rat, pig, bovine | 
| Host / Isotype | Rabbit / IgG | 
| Class | Polyclonal | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag3167 Product name: Recombinant human CRTC2,TORC2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 394-693 aa of BC053562 Sequence: APALSSSSSSSSTSSPVLGAPSYPASTPGASPHHRRVPLSPLSLLAGPADARRSQQQLPKQFSPTMSPTLSSITQGVPLDTSKLSTDQRLPPYPYSSPSLVLPTQPHTPKSLQQPGLPSQSCSVQSSGGQPPGRQSHYGTPYPPGPSGHGQQSYHRPMSDFNLGNLEQFSMESPSASLVLDPPGFSEGPGFLGGEGPMGGPQDPHTFNHQNLTHCSRHGSGPNIILTGDSSPGFSKEIAAALAGVPGFEVSAAGLELGLGLEDELRMEPLGLEGLNMLSDPCALLPDPAVEESFRSDRLQ Predict reactive species | 
                                    
| Full Name | CREB regulated transcription coactivator 2 | 
| Calculated Molecular Weight | 693 aa, 73 kDa | 
| Observed Molecular Weight | 73 kDa | 
| GenBank Accession Number | BC053562 | 
| Gene Symbol | TORC2 | 
| Gene ID (NCBI) | 200186 | 
| RRID | AB_2260910 | 
| Conjugate | Unconjugated | 
| Form | Liquid | 
| Purification Method | Antigen affinity purification | 
| UNIPROT ID | Q53ET0 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. | 
Background Information
CRTC2, also named as TORC2, belongs to the TORC family. It is a transcriptional coactivator for CREB1 which activates transcription through both consensus and variant cAMP response element (CRE) sites. It acts as a coactivator, in the SIK/TORC signaling pathway, being active when dephosphorylated and acts independently of CREB1 'Ser-133' phosphorylation. CRTC2 enhances the interaction of CREB1 with TAF4. Ir regulates gluconeogenesis as a component of the LKB1/AMPK/TORC2 signaling pathway. CRTC2 regulates the expression of specific genes such as the steroidogenic gene, StAR. TORC2 was recently shown to be an important regulator of gluconeogenesis in the livers of mammals. It is one of the other key regulators of CRE-dependent MIE gene expression in NT2 cells. This regulation is linked to VIP-induced TORC2 dephosphorylation and translocation to the nucleus. (PMID: 19369332, 20504934 ) .
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for TORC2 antibody 12497-1-AP | Download protocol | 
| IHC protocol for TORC2 antibody 12497-1-AP | Download protocol | 
| WB protocol for TORC2 antibody 12497-1-AP | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 
Publications
| Species | Application | Title | 
|---|---|---|
Adv Sci (Weinh) cAMP-Induced Nuclear Condensation of CRTC2 Promotes Transcription Elongation and Cystogenesis in Autosomal Dominant Polycystic Kidney Disease.
  | ||
Mol Cell LKB1 controls inflammatory potential through CRTC2-dependent histone acetylation | ||
Am J Transplant The tacrolimus-induced glucose homeostasis imbalance in terms of the liver: From bench to bedside. | ||
J Neurosci Clock and light regulation of the CREB coactivator CRTC1 in the suprachiasmatic circadian clock. | ||
Biochem Pharmacol Piperlongumine, a natural alkaloid from Piper longum L. ameliorates metabolic-associated fatty liver disease by antagonizing the thromboxane A2 receptor | ||

























