Tested Applications
| Positive WB detected in | mouse brain tissue, Y79 cells, rat brain tissue |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | SH-SY5Y cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
13997-1-AP targets Cryptochrome 2 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag5085 Product name: Recombinant human CRY2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 243-593 aa of BC041814 Sequence: HLERKAWVANYERPRMNANSLLASPTGLSPYLRFGCLSCRLFYYRLWDLYKKVKRNSTPPLSLFGQLLWREFFYTAATNNPRFDRMEGNPICIQIPWDRNPEALAKWAEGKTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWVSWESGVRVFDELLLDADFSVNAGSWMWLSCSAFFQQFFHCYCPVGFGRRTDPSGDYIRRYLPKLKAFPSRYIYEPWNAPESIQKAAKCIIGVDYPRPIVNHAETSRLNIERMKQIYQQLSRYRGLCLLASVPSCVEDLSHPVAEPSSSQAGSMSSAGPRPLPSGPASPKRKLEAAEEPPGEELSKRARVAELPTPELPSKDA Predict reactive species |
| Full Name | cryptochrome 2 (photolyase-like) |
| Calculated Molecular Weight | 593 aa, 67 kDa |
| Observed Molecular Weight | 65-70 kDa |
| GenBank Accession Number | BC041814 |
| Gene Symbol | CRY2 |
| Gene ID (NCBI) | 1408 |
| RRID | AB_10860100 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q49AN0 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Cryptochrome circadian clock 2 (CRY2) is a flavin adenine dinucleotide-binding protein that is a key component of the circadian core oscillator complex, which regulates the circadian clock. Loss of CRY2 stabilizes c-MYC and enhances cellular transformation. CRY2 can function as a co-factor for the SCF substrate adaptor FBXL3 (PMID: 27840026). CRY2 has two isoform with MW of 60 and 67 kDa. This antibody can recognize CRY1 and CRY2 due to the high homology.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Cryptochrome 2 antibody 13997-1-AP | Download protocol |
| IHC protocol for Cryptochrome 2 antibody 13997-1-AP | Download protocol |
| IP protocol for Cryptochrome 2 antibody 13997-1-AP | Download protocol |
| WB protocol for Cryptochrome 2 antibody 13997-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Anti-CRY2 Antibody (Cat# 13997-1-AP) has accumulated 46 citations in journals including Molecular Cell, Science Advances, Cell Death & Differentiation, Current Biology, PLoS Biology, FASEB Journal, American Journal of Pathology, and eLife. Associated research fields span circadian rhythm regulation, neuroscience, metabolism, inflammation, cancer biology, and sleep disorders.
| Species | Application | Title |
|---|---|---|
Mol Cell Circadian PERIOD proteins regulate TC-DSB repair through anchoring to the nuclear envelope
| ||
Sci Adv Time-of-day specificity of anticancer drugs may be mediated by circadian regulation of the cell cycle. | ||
Cell Death Differ CircRNA-vgll3 promotes osteogenic differentiation of adipose-derived mesenchymal stem cells via modulating miRNA-dependent integrin α5 expression. | ||
Cell Death Dis hPER3 promotes adipogenesis via hHSP90AA1-mediated inhibition of Notch1 pathway. | ||
Cell Death Dis Cryptochrome 2 acetylation attenuates its antiproliferative effect in breast cancer | ||
J Neuroinflammation Cry2 deficiency leads to cognitive impairment through the microbiota-gut-brain axis mediated S1P/NLRP3/IL-1β pathway in mice. |
Reviews
What customers say
Both reviewers gave this antibody a perfect 5-star rating for Western Blot applications. One user tested it at 1:1000 dilution on human cardiomyocytes, keratinocytes, and mouse liver and skin tissues, confirming its cross-reactivity across species and tissue types. The other user worked with U2OS cells at 1:800 dilution and reported a single clear band at the expected molecular weight. Overall, users find the antibody specific, reliable, and effective for detecting its target in both human and mouse samples.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Priya (Verified Customer) (01-11-2023) | I have used this for human cardiomyocytes cell line and mice liver and kin tisssue
|
Julia (Verified Customer) (01-14-2022) | Gives one clear band with the expected size.
 |
