• Featured Product
  • KD/KO Validated

CYP24A1 Polyclonal antibody

CYP24A1 Polyclonal Antibody for WB, IHC, IP, ELISA
Cat No. 21582-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human and More (2)

Applications

WB, IHC, IF, IP, ELISA

Cytochrome P450 24A1, CYP24, CP24, 24-OHase, 24 OHase

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells, HeLa cells
Positive IP detected inHeLa cells
Positive IHC detected inhuman kidney tissue, human prostate cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:20-1:200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

21582-1-AP targets CYP24A1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag16134

Product name: Recombinant human CYP24A1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-350 aa of BC109083

Sequence: MSSPISKSRSLAAFLQQLRSPRQPPRLVTSTAYTSPQPREVPVCPLTAGGETQNAAALPGPTSWPLLGSLLQILWKGGLKKQHDTLVEYHKKYGKIFRMKLGSFESVHLGSPCLLEALYRTESAYPQRLEIKPWKAYRDYRKEGYGLLILEGEDWQRVRSAFQKKLMKPGEVMKLDNKINEVLADFMGRIDELCDERGHVEDLYSELNKWSFESICLVLYEKRFGLLQKNAGDEAVNFIMAIKTMMSTFGRMMVTPVELHKSLNTKVWQDHTLAWDTIFKSVKACIDNRLEKYSQQPSADFLCDIYHQNRLSKKELYAAVTELQLAAVETTANSLMWILYNLSRNPQVQQ

Predict reactive species
Full Name cytochrome P450, family 24, subfamily A, polypeptide 1
Calculated Molecular Weight 514 aa, 59 kDa
Observed Molecular Weight 54-59 kDa
GenBank Accession NumberBC109083
Gene Symbol CYP24A1
Gene ID (NCBI) 1591
RRIDAB_10792804
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ07973
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CYP24A1(1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial) catalyzes the NADPH-dependent 24-hydroxylation of calcidiol (25-hydroxyvitamin D3) and 1-alpha,25-dihydroxyvitamin D3. Cholecalciferol is metabolised by the 25-hydroxylases (CYP2R1 and CYP27A1) in the liver, before 25-hydroxycholecalciferol (25(OH)D3) relocates to the circulation (PMID:20362668). The gene CYP24A1 has three isoforms, for the transit peptide "mitochondrial domain" removed, the MW of CYP24A1 will be 55-59 kDa, 47-51 kDa and 43 kDa. This antibody is specific to CYP24A1.

Protocols

Product Specific Protocols
IHC protocol for CYP24A1 antibody 21582-1-APDownload protocol
IP protocol for CYP24A1 antibody 21582-1-APDownload protocol
WB protocol for CYP24A1 antibody 21582-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB,IHC

Cancer Lett

TAZ regulates cell proliferation and sensitivity to vitamin D3 in intrahepatic cholangiocarcinoma.

Authors - Heng Xiao
  • KD Validated
mouseWB

Acta Physiol (Oxf)

Intestinal epithelial ablation of Pit-2/Slc20a2 in mice leads to sustained elevation of vitamin D3 upon dietary restriction of phosphate.

Authors - Eva Maria Pastor-Arroyo
mouseWB

J Bone Miner Res

Exercise May Ameliorate the Detrimental Side Effects of High Vitamin D Supplementation on Muscle Function in Mice.

Authors - Danielle A Debruin
humanWB

Cancer Commun (Lond)

Squalene epoxidase promotes colorectal cancer cell proliferation through accumulating calcitriol and activating CYP24A1-mediated MAPK signaling.

Authors - Luwei He
humanWB, IHC

J Steroid Biochem Mol Biol

Eldecalcitol (ED-71), an Analog of 1α, 25-dihydroxy Vitamin D3 as a Potential Anti-cancer Agent for Oral Squamous Cell Carcinomas.

Authors - T Shintani
mouseWB

J Physiol

1,25(OH)2 vitamin D3 stimulates active phosphate transport but not paracellular phosphate absorption in mouse intestine.

Authors - Nati Hernando

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Kenzo (Verified Customer) (08-30-2023)

This antibody appeared to work pretty well for immunofluorescence in mouse tissues.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: Kidney
Loading...
||
New chat Able
正在加载,请稍候...