Tested Applications
| Positive WB detected in | HeLa cells, mouse testis tissue, rat spleen tissue, rat testis tissue, Jurkat cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | mouse brain tissue, mouse testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
| Positive FC (Intra) detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
17721-1-AP targets DHX9 in WB, IHC, IF/ICC, IP, CoIP, ChIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, bovine |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag12104 Product name: Recombinant human DHX9 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-300 aa of BC014246 Sequence: MGDVKNFLYAWCGKRKMTPSYEIRAVGNKNRQKFMCEVQVEGYNYTGMGNSTNKKDAQSNAARDFVNYLVRINEIKSEEVPAFGVASPPPLTDTPDTTANAEGDLPTTMGGPLPPHLALKAENNSEVGASGYGVPGPTWDRGANLKDYYSRKEEQEVQATLESEEVDLNAGLHGNWTLENAKARLNQYFQKEKIQGEYKYTQVGPDHNRSFIAEMTIYIKQLGRRIFAREHGSNKKLAAQSCALSLVRQLYHLGVVEAYSGLTKKKEGETVEPYKVNLSQDLEHQLQNIIQELNLEILPP Predict reactive species |
| Full Name | DEAH (Asp-Glu-Ala-His) box polypeptide 9 |
| Calculated Molecular Weight | 1270 aa, 141 kDa |
| Observed Molecular Weight | 140 kDa |
| GenBank Accession Number | BC014246 |
| Gene Symbol | DHX9 |
| Gene ID (NCBI) | 1660 |
| RRID | AB_2092506 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q08211 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
RNA helicases play important roles in transcription, RNA processing, translation, and RNA replication. DEAD box proteins are putative RNA helicases that have a characteristic Asp-Glu-Ala-Asp (DEAD) box as 1 of 8 highly conserved sequence motifs. DHX9 a member of the DEAH family of proteins, which possess a double-stranded RNA-binding domain (dsRBD) and a helicase domain [PMID:20569003]. It unwinds double-stranded DNA and RNA in a 3' to 5' direction. Alteration of secondary structure of DHX9 may subsequently influence interactions with proteins or other nucleic acids. It is also a component of the CRD-mediated complex that promotes MYC mRNA stability. In addition, it is involved with LARP6 in the stabilization of type I collagen mRNAs for CO1A1 and CO1A2[PMID: 19029303, 22190748].
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for DHX9 antibody 17721-1-AP | Download protocol |
| IF protocol for DHX9 antibody 17721-1-AP | Download protocol |
| IHC protocol for DHX9 antibody 17721-1-AP | Download protocol |
| IP protocol for DHX9 antibody 17721-1-AP | Download protocol |
| WB protocol for DHX9 antibody 17721-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The anti-DHX9 antibody (Cat# 17721-1-AP) has 60 citations spanning journals including Cell, Nature Communications, Molecular Cell, Immunity, Cancer Research, Nucleic Acids Research, Cell Reports, Genes & Development, and Developmental Cell. Research fields cover R-loop biology, RNA splicing, cancer progression (hepatocellular, gastric, colorectal, breast), innate immunity and antiviral responses, epigenetics, neurodegeneration, atherosclerosis, and stem cell reprogramming.
| Species | Application | Title |
|---|---|---|
Signal Transduct Target Ther DNA/RNA-binding protein KIN17 supports esophageal cancer progression via resolving noncanonical STING activation induced by R-loop. | ||
Mol Cancer Inhibition of PRMT5 triggers synthetic lethality in ARID1A-deficient endometrial cancer by promoting aberrant R-loop accumulation. | ||
Immunity Flavin adenine dinucleotide is an endogenous suppressor for cytosolic DNA and RNA sensors to modulate innate immunity. | ||
Cancer Res PICH activates Cyclin A1 transcription to drive S-phase progression and chemoresistance in gastric cancer | ||
Nat Commun Structural basis for terminal loop recognition and stimulation of pri-miRNA-18a processing by hnRNP A1. |
Reviews
What customers say
Both reviews are 5-star ratings for Western Blot applications. One user reported a strong DHX9 band at the expected molecular weight using a 1:1000 dilution with 1-hour incubation at room temperature in HeLa extracts. The other user simply noted it as a "good Ab" used at 1:2000 dilution in macrophages. Overall, customers express satisfaction with the antibody's performance in WB, confirming clear and specific signal detection across different cell types and dilutions.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Sonam (Verified Customer) (10-16-2025) | Good Ab
|
Roy (Verified Customer) (06-12-2024) | Strong DHX9 band detected at the right size by WB (1/1000- 1h incubation at RT) with HeLa extracts.
|
