Tested Applications
| Positive WB detected in | mouse placenta tissue, mouse ovary tissue, 3T3-L1 cells, MCF-7 cells, A549 cells, mouse brain tissue |
| Positive IHC detected in | human pancreas cancer tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 3 publications below |
| WB | See 11 publications below |
| IHC | See 11 publications below |
| IF | See 3 publications below |
| FC | See 1 publications below |
Product Information
10636-1-AP targets DLK1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0991 Product name: Recombinant human DLK1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 83-383 aa of BC007741 Sequence: ELCDRDVRACSSAPCANNGTCVSLDDGLYECSCAPGYSGKDCQKKDGPCVINGSPCQHGGTCVDDEGRASHASCLCPPGFSGNFCEIVANSCTPNPCENDGVCTDIGGDFRCRCPAGFIDKTCSRPVTNCASSPCQNGGTCLQHTQVSYECLCKPEFTGLTCVKKRALSPQQVTRLPNGYGLAYRLTPGVHELPVQQPEHRILKVSMKELNKKTPLLTEGQAICFTILGVLTSLVVLGTVGIVFLNKCETWVSNLRYNHMLRKKKNLLLQYNSGEDLAVNIIFPEKIDMTTFSKEAGDEEI Predict reactive species |
| Full Name | delta-like 1 homolog (Drosophila) |
| Calculated Molecular Weight | 41 kDa |
| Observed Molecular Weight | 45-60 kDa |
| GenBank Accession Number | BC007741 |
| Gene Symbol | DLK1 |
| Gene ID (NCBI) | 8788 |
| RRID | AB_2092679 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P80370 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
DLK1, also named PREF1, FA1, or pG2, is a transmembrane protein belonging to the epidermal growth factor (EGF)-like superfamily (PMID: 8095043). It contains six EGF-like repeats in the extracellular region. DLK1 is abundant in preadipocytes and regulate adipocyte differentiation negatively (PMID: 8500166). Deficiency of DLK1 gives rise to growth retardation and accelerated adiposity in mouse model. Expression of DLK1 is found in tumors with neuroendocrine features that implies DLK1 may be involved in neuroendocrine differentiation (PMID: 8095043). It has been reported overexpression of DLK1 could lead to the development of metabolic abnormalities by impairment of adipocyte function in mice (PMID: 12588883). The gene of DLK1 maps to chromosome 14q32, and encodes a 383-amino acid protein with a calculated molecular mass of 41 kDa. In preadipocytes, multiple discrete forms of DLK1 protein of 45-60 kDa are present, owing in part to N-linked glycosylation (PMID: 8500166).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for DLK1 antibody 10636-1-AP | Download protocol |
| WB protocol for DLK1 antibody 10636-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Gastroenterology Activation of β-catenin and Yap1 in human hepatoblastoma and induction of hepatocarcinogenesis in mice. | ||
Nat Commun GREB1 induced by Wnt signaling promotes development of hepatoblastoma by suppressing TGFβ signaling. | ||
PLoS Genet Gene dosage effects of the imprinted delta-like homologue 1 (dlk1/pref1) in development: implications for the evolution of imprinting. | ||
Cell Death Differ The miR-181d-regulated metalloproteinase Adamts1 enzymatically impairs adipogenesis via ECM remodeling. | ||
Meat Sci Dietary vitamin A restriction affects adipocyte differentiation and fatty acid composition of intramuscular fat in Iberian pigs. | ||
Front Cell Dev Biol A Na+/K+ ATPase Pump Regulates Chondrocyte Differentiation and Bone Length Variation in Mice. |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Angélique (Verified Customer) (12-04-2019) | Good specific signal without background staining in IHC on mouse liver and liver tumor sections.
![]() |




















