• Featured Product
  • KD/KO Validated

ELK1 Polyclonal antibody

ELK1 Polyclonal Antibody for ELISA
Cat No. 14507-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

ELK1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

14507-1-AP targets ELK1 in WB, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag5966

Product name: Recombinant human ELK1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-428 aa of BC056150

Sequence: MDPSVTLWQFLLQLLREQGNGHIISWTSRDGGEFKLVDAEEVARLWGLRKNKTNMNYDKLSRALRYYYDKNIIRKVSGQKFVYKFVSYPEVAGCSTEDCPPQPEVSVTSTMPNVAPAAIHAAPGDTVSGKPGTPKGAGMAGPGGLARSSRNEYMRSGLYSTFTIQSLQPQPPPHPRPAVVLPSAAPAGAAAPPSGSRSTSPSPLEACLEAEEAGLPLQVILTPPEAPNLKSEELNVEPGLGRALPPEVKVEGPKEELEVAGERGFVPETTKAEPEVPPQEGVPARLPAVVMDTAGQAGGHAASSPEISQPQKGRKPRDLELPLSPSLLGGPGPERTPGSGSGSGLQAPGPALTPSLLPTHTLTPVLLTPSSLPPSIHFWSTLSPIAPRSPAKLSFQFPSSGSAQVHIPSISVDGLSTPVVLSPGPQKP

Predict reactive species
Full Name ELK1, member of ETS oncogene family
Calculated Molecular Weight 45 kDa
GenBank Accession NumberBC056150
Gene Symbol ELK1
Gene ID (NCBI) 2002
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP19419
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

E twenty-six (ETS)-like transcription factor 1, also known as ELK1, is a member of the Ets family of transcription factors and of the ternary complex factor (TCF) subfamily. It is targeted in the nucleus by three major MAP kinase pathways as well as the CaMKII pathway. phosphorylation of nuclear Elk1 enhances its ability to bind DNA at serum response elements and stimulate transcription of immediate early genes. Elk1 plays important roles in various contexts, including long-term memory formation, drug addiction, Alzheimer's disease, down syndrome, breast cancer, and depression. This antibody got an 62 kd band in western blotting maybe duo to its phosphorylation

Publications

SpeciesApplicationTitle
humanWB

Br J Pharmacol

L-Hcy-induced cathepsin V mediates the vascular endothelial inflammation in hyperhomocysteinemia.

Authors - Yi-Ping Leng
humanWB

Gene

Competitive regulation of IPO4 transcription by ELK1 and GABP.

Authors - Pengpeng Xu
  • KD Validated
humanWB

Oncol Lett

MicroRNA-326 suppresses the proliferation, migration and invasion of cervical cancer cells by targeting ELK1.

Authors - Ping Zhang
Loading...
||
New chat Able
正在加载,请稍候...