Tested Applications
| Positive WB detected in | HT-29 cells, HepG2 cells, A549 cells, MDA-MB-231 cells |
| Positive IP detected in | HepG2 cells |
| Positive IHC detected in | human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive FC (Intra) detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:2000-1:8000 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
22474-1-AP targets FOXA2 in WB, IHC, IF, FC (Intra), IP, CoIP, chIP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, chicken |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag18221 Product name: Recombinant human FOXA2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-160 aa of BC011780 Sequence: MLGAVKMEGHEPSDWSSYYAEPEGYSSVSNMNAGLGMNGMNTYMSMSAAAMGSGSGNMSAGSMNMSSYVGAGMSPSLAGMSPGAGAMAGMGGSAGAAGVAGMGPHLSPSLSPLGGQAAGAMGGLAPYANMNSMSPMYGQAGLSRARDPKTYRRSYTHAKP Predict reactive species |
| Full Name | forkhead box A2 |
| Calculated Molecular Weight | 457 aa, 48 kDa |
| Observed Molecular Weight | 55-65 kDa |
| GenBank Accession Number | BC011780 |
| Gene Symbol | FOXA2 |
| Gene ID (NCBI) | 3170 |
| RRID | AB_2879110 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9Y261 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
FOXA2 also named as HNF 3 beta or TCF3B is a 457 amino acid protein, which contains one fork-head DNA-binding domains. FOXA2 can Shuttle between the nucleus and cytoplasm in a CRM1-dependent manner. Phosphorylation on FOXA2 Thr-156 abolishes binding to target promoters and subsequent transcription activation upon INS stimulation. FOXA2 as a transcription factor involves in embryonic development, establishment of tissue-specific gene expression and regulation of gene expression in differentiated tissues. The molecular weight of FOXA2 is 48kDa, but the phosphorylated FOXA2 may be a 55-65kDa protein.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for FOXA2 antibody 22474-1-AP | Download protocol |
| IHC protocol for FOXA2 antibody 22474-1-AP | Download protocol |
| IP protocol for FOXA2 antibody 22474-1-AP | Download protocol |
| WB protocol for FOXA2 antibody 22474-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The anti-FOXA2 antibody (Cat# 22474-1-AP) has 41 citations across journals including Cell Research, Nature Communications, Cancer Research, Neuron, Cell Reports, Biomaterials, EBioMedicine, Genome Medicine, iScience, Stem Cell Research & Therapy, Cancer Cell International, and others. Research fields span oncology (prostate, colorectal, breast, lung, gastric, liver cancers), neuroscience, stem cell biology, epigenetics, metabolic disease, and developmental biology.
| Species | Application | Title |
|---|---|---|
Cell Res Tissue-specific transcription reprogramming promotes liver metastasis of colorectal cancer. | ||
Cancer Res The Histone Methyltransferase KMT2D Is a Critical Mediator of Lineage Plasticity and Therapeutic Response in Castration-Resistant Prostate Cancer. | ||
Bone Res PTH induced osteoblast Slit3 to decrease aberrant sensory innervation in degenerated vertebral endplates to relieve low back pain in mice. | ||
Nat Commun FOXA2 rewires AP-1 for transcriptional reprogramming and lineage plasticity in prostate cancer | ||
Nat Commun Live imaging and functional characterization of the avian hypoblast redefine the mechanisms of primitive streak induction. | ||
Neuron Alpha-synuclein mutations mislocalize cytoplasmic p300 compromising autophagy, which is rescued by ACLY inhibition |
Reviews
What customers say
All three reviews are 5-star ratings. Users report excellent performance in both Western Blot and Immunofluorescence across mouse liver tissue, mouse primary NPCs, and human hiPSC-derived neuroectodermal cells. Recommended dilutions are 1:2000–1:2500 for WB (in TBST) and 1:200 for IF (in 1X PBS). Reviewers consistently describe the antibody as working beautifully with clear results in both applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Gökçe Nihan (Verified Customer) (10-02-2025) | Immunofluorescence and Western blot applications worked beautifully with this antibody for both mouse and human samples.
|
Kamal (Verified Customer) (07-05-2023) | Worked when diluted in TBST for WB and 1X PBS for IFC.
|
Kamal (Verified Customer) (07-05-2023) | Worked when diluted in TBST for WB and 1X PBS for IFC.
|
