Tested Applications
| Positive WB detected in | HCT 116 cells, rat spleen tissue, MCF-7 cells |
| Positive IF/ICC detected in | A375 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
23066-1-AP targets FOXC2 in WB, IHC, IF/ICC, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag19378 Product name: Recombinant human FOXC2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 205-501 aa of BC113437 Sequence: KEAEKKVVIKSEAASPALPVITKVETLSPESALQGSPRSAASTPAGSPDGSLPEHHAAAPNGLPGFSVENIMTLRTSPPGGELSPGAGRAGLVVPPLALPYAAAPPAAYGQPCAQGLEAGAAGGYQCSMRAMSLYTGAERPAHMCVPPALDEALSDHPSGPTSPLSALNLAAGQEGALAATGHHHQHHGHHHPQAPPPPPAPQPQPTPQPGAAAAQAASWYLNHSGDLNHLPGHTFAAQQQTFPNVREMFNSHRLGIENSTLGESQVSGNASCQLPYRSTPPLYRHAAPYSYDCTKY Predict reactive species |
| Full Name | forkhead box C2 (MFH-1, mesenchyme forkhead 1) |
| Calculated Molecular Weight | 501 aa, 54 kDa |
| Observed Molecular Weight | 54-68 kDa |
| GenBank Accession Number | BC113437 |
| Gene Symbol | FOXC2 |
| Gene ID (NCBI) | 2303 |
| RRID | AB_2879204 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q99958 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Forkhead box protein C2 (FOXC2) also known as forkhead-related protein FKHL14 (FKHL14), transcription factor FKH-14, or mesenchyme fork head protein 1 (MFH1) is a protein that in humans is encoded by the FOXC2 gene. FOXC2 is a member of the fork head box (FOX) family of transcription factors. FOX transcription factors are expressed during development and are associated with a number of cellular and developmental differentiation processes. FOXC2 is required during early development of the kidneys, including differentiation of podocytes and maturation of the glomerular basement membrane. It is also involved in the early development of the heart. FOXC2 is also involved in cancer metastases. In particular, expression of FOXC2 is induced when epithelial cells undergo an epithelial-mesenchymal transition (EMT) and become mesenchymal looking cells. (PMID: 8674414 9169153 19935708) This antibody recognizes the 56 kDa FOXC2 protein, but the phosphorylated FOXC2 may be a 56-65 kDa protein. The 62kDa band was also detected in the study(PMID: 19540201).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for FOXC2 antibody 23066-1-AP | Download protocol |
| WB protocol for FOXC2 antibody 23066-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The FOXC2 antibody (Cat# 23066-1-AP) has 23 citations published in journals including Nature Communications, Nature Cardiovascular Research, Cancer Research, Theranostics, Advanced Science, Cell Death & Disease, Clinical Translational Medicine, Cell Signaling, Experimental Cell Research, and others. Research fields span oncology (EMT, metastasis, tumor immune evasion), cardiovascular biology (valve remodeling, pulmonary hypertension), lymphatic physiology, neurology (traumatic brain injury), fibrosis, angiogenesis, and infectious disease.
| Species | Application | Title |
|---|---|---|
Cancer Res GLI2 Facilitates Tumor Immune Evasion and Immunotherapeutic Resistance by Coordinating WNT and Prostaglandin Signaling. | ||
Nat Commun DSS1 inhibits autophagy to activate epithelial-mesenchymal transition in a pro-metastatic niche of renal cell carcinoma. | ||
Theranostics Hypoxia-induced feedback of HIF-1α and lncRNA-CF129 contributes to pancreatic cancer progression through stabilization of p53 protein.
| ||
J Exp Clin Cancer Res Stanniocalcin 1 promotes metastasis, lipid metabolism and cisplatin chemoresistance via the FOXC2/ITGB6 signaling axis in ovarian cancer.
| ||
Adv Sci (Weinh) Aloe-Emodin Targeting FOXC2 Disrupts NETs Formation and EMT-Driven Postoperative Peritoneal Adhesion Through TGF-β1-Smad2/3 Pathway.
| ||
Nat Cardiovasc Res APOE-NOTCH axis governs elastogenesis during human cardiac valve remodeling |
