FOXP1 Polyclonal antibody

FOXP1 Polyclonal Antibody for ELISA
Cat No. 18596-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

ELISA

12CC4, forkhead box P1, Forkhead box protein P1, FOXP1, hFKH1B, HSPC215, QRF1

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

18596-1-AP targets FOXP1 in ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag13402

Product name: Recombinant human FOXP1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-114 aa of BC005055

Sequence: MMQESGTETKSNGSAIQNGSGGSNHLLECGGLREGRSNGETPAVDIGAADLAHAQQQQQQWHLINHQPSRSPSSWLKRLISSPWELEVLQVPLWGAVAETKMSGPVCQPNPSPF

Predict reactive species
Full Name forkhead box P1
Calculated Molecular Weight 114 aa, 12 kDa
GenBank Accession NumberBC005055
Gene Symbol FOXP1
Gene ID (NCBI) 27086
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9H334
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FOXP1, also named as HSPC215, is a transcriptional repressor that plays an important role in the specification and differentiation of lung epithelium. It is essential transcriptional regulator of B cell developmen. A chromosomal aberration involving FOXP1 is found in acute lymphoblastic leukemia. FOXP1 is implicated in the pathogenesis of DLBCL and MALT lymphomas, through the identification of recurrent chromosome translocations that upregulate its expression levels and the correlation between high-level FOXP1 expression and poor prognosis. On initial examination, these data seem contrary to findings from the study of FOXP1 in epithelial malignancies, which suggest that it may represent a tumor suppressor gene. Convincing evidence linking the loss of the FOXP1 N-terminus and malignancy has already been generated through the study of recurrent viral integration sites that generate avian nephroblastomas.(PMID:18077790) The antibody recognize 2 smaller 60-65kd isoforms in mouse Lung.

Loading...
||
New chat Able
正在加载,请稍候...