Phospholemman/FXYD1 Polyclonal antibody

Phospholemman/FXYD1 Polyclonal Antibody for WB, IP, IHC, ELISA
Cat No. 13721-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (2)

Applications

WB, IP, IF, IHC, ELISA

FXYD1, Phospholemman, Phospholemman/FXYD1, PLM

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inhuman skeletal muscle tissue, rat skeletal muscle tissue, mouse skeletal muscle tissue, rat heart tissue, mouse heart tissue, mouse kidney tissue, human brain tissue
Positive IP detected inmouse heart tissue
Positive IHC detected inmouse heart tissue, human skeletal muscle tissue, human heart tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1500
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

13721-1-AP targets Phospholemman/FXYD1 in WB, IP, IF, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig, rabbit
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag4669

Product name: Recombinant human FXYD1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-92 aa of BC032800

Sequence: MASLGHILVFCVGLLTMAKAESPKEHDPFTYDYQSLQIGGLVIAGILFILGILIVLSRRCRCKFNQQQRTGEPDEEEGTFRSSIRRLSTRRR

Predict reactive species
Full Name FXYD domain containing ion transport regulator 1
Calculated Molecular Weight 92 aa, 10 kDa
Observed Molecular Weight 10-15 kDa
GenBank Accession NumberBC032800
Gene Symbol FXYD1
Gene ID (NCBI) 5348
RRIDAB_2108296
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO00168
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FXYD1, also named as PLM and Phospholemman, belongs to the FXYD family. FXYD1 induces a hyperpolarization-activated chloride current when expressed in Xenopus oocytes. It may have a functional role in muscle contraction. FXYD1 is a partner protein and regulator of the Na+,K+-ATPase (Na+,K+-pump). It may play a role in the acute regulation of the Na+,K+-ATPase response to exercise. (PMID: 20595385, 21653224)

Protocols

Product Specific Protocols
IHC protocol for Phospholemman/FXYD1 antibody 13721-1-APDownload protocol
IP protocol for Phospholemman/FXYD1 antibody 13721-1-APDownload protocol
WB protocol for Phospholemman/FXYD1 antibody 13721-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB,IF

Sci Rep

Over-expression of microRNA-1 causes arrhythmia by disturbing intracellular trafficking system.

Authors - Xiaomin Su
ratWB

J Gen Physiol

Distinct α2 Na,K-ATPase membrane pools are differently involved in early skeletal muscle remodeling during disuse.

Authors - Violetta V Kravtsova
ratWB

J Biol Chem

The nicotinic acetylcholine receptor and the Na,K-ATPase alpha2 isoform interact to regulate membrane electrogenesis in skeletal muscle.

Authors - Heiny Judith A JA
ratWB

J Physiol

Fatigue-induced change in T-system excitability and its major cause in rat fast-twitch skeletal muscle in vivo.

Authors - Daiki Watanabe
humanWB

J Physiol

Cycling with blood flow restriction improves performance and muscle K+ regulation and alters the effect of anti-oxidant infusion in humans.

Authors - Danny Christiansen
human,mouse,ratWB

Am J Physiol Endocrinol Metab

Effect of exercise and training on phospholemman phosphorylation in human skeletal muscle.

Authors - Benziane Boubacar B
Loading...
||
New chat Able
正在加载,请稍候...