Use Able AI chat for product recommendations

GAP43 Polyclonal antibody

GAP43 Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, IP, ELISA

Cat No. 16971-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (5)

Applications

WB, IHC, IF/ICC, IF-P, IP, CoIP, ELISA

Axonal membrane protein GAP 43, Axonal membrane protein GAP-43, B 50, growth associated protein 43, Growth-associated protein 43

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse brain tissue, rat lung tissue, SH-SY5Y cells, rat brain tissue, Neuro-2a cells
Positive IP detected inmouse brain tissue
Positive IHC detected inmouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse brain tissue
Positive IF/ICC detected inSH-SY5Y cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

16971-1-AP targets GAP43 in WB, IHC, IF/ICC, IF-P, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig, canine, zebrafish, hamster, gekko japonicus
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag9294

Product name: Recombinant human GAP43 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-238 aa of BC007936

Sequence: MLCCMRRTKQVEKNDDDQKIEQDGIKPEDKAHKAATKIQASFRGHITRKKLKGEKKDDVQAAEAEANKKDEAPVADGVEKKGEGTTTAEAAPATGSKPDEPGKAGETPSEEKKGEGDAATEQAAPQAPASSEEKAGSAETESATKASTDNSPSSKAEDAPAKEEPKQADVPAAVTAAAATTPAAEDAAAKATAQPPTETGESSQAEENIEAVDETKPKESARQDEGKEEEPEADQEHA

Predict reactive species
Full Name growth associated protein 43
Calculated Molecular Weight 238 aa, 25 kDa
Observed Molecular Weight 43 kDa
GenBank Accession NumberBC007936
Gene Symbol GAP43
Gene ID (NCBI) 2596
RRIDAB_2278881
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP17677
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The neuronal growth-associated protein GAP43 is known as neuromodulin, B-50, P-57, F1, and pp46. Deficiency of GAP43 in mice results in death early in the postnatal period. GAP43 is one of the main substrates for protein kinase C in the brain. GAP43 is an intracellular growth-associated protein that appears to assist neuronal pathfinding and branching during development and regeneration and may contribute to presynaptic membrane changes in the adult, leading to neurotransmitter release, endocytosis, and synaptic vesicle recycling, long-term potentiation, spatial memory formation, and learning. The predicted molecular weight of about 25 kDa is much lower than the apparent observed molecular weight of 43 kDa on SDS-PAGE gels, and this occurs because the highly charged nature of GAP43 causes it to bind less than the average amount of SDS per amino acid, and because the protein has an elongated structure.

Protocols

Product Specific Protocols
IF protocol for GAP43 antibody 16971-1-APDownload protocol
IHC protocol for GAP43 antibody 16971-1-APDownload protocol
IP protocol for GAP43 antibody 16971-1-APDownload protocol
WB protocol for GAP43 antibody 16971-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
ratWB

Adv Sci (Weinh)

An Important Function of Petrosiol E in Inducing the Differentiation of Neuronal Progenitors and in Protecting Them against Oxidative Stress.

Authors - Jing Liu
ratIHC

Biofabrication

Pulsed electromagnetic field-assisted reduced graphene oxide composite 3D printed nerve scaffold promotes sciatic nerve regeneration in rats

Authors - Zichao Wang
ratWB

Mater Today Bio

Ropivacaine microsphere-loaded electroconductive nerve dressings for long-acting analgesia and functional recovery following diabetic peripheral nerve injury

Authors - Fangguo Liang
ratWB

Phytomedicine

Ginsenoside Rb1 protects hippocampal neurons in depressed rats based on mitophagy-regulated astrocytic pyroptosis

Authors - Yannan Li
ratWB

Environ Pollut

Combined exposure of lead and high-fat diet enhanced cognitive decline via interacting with CREB-BDNF signaling in male rats.

Authors - Rundong Liu
ratWB

Aging (Albany NY)

Enriched environment remedies cognitive dysfunctions and synaptic plasticity through NMDAR-Ca2+-Activin A circuit in chronic cerebral hypoperfusion rats.

Authors - Xin Zhang

Reviews

    5.0 out of 5
Add a review

1 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Azita (Verified Customer) (05-31-2021)

Human primary cortical neurons was labelled with 1/500 GAP43. Very strong labelling.

  • Applications: Immunohistochemistry
  • Primary Antibody Dilution: 1/500
  • Cell Tissue Type: Human primary cortical neurons
GAP43 Antibody Immunohistochemistry validation (1/500 dilution) in Human primary cortical neurons (Cat no:16971-1-AP)
Loading...
||
New chat

Able™

正在加载,请稍候...