Tested Applications
| Positive WB detected in | mouse kidney tissue, rat kidney tissue |
| Positive IHC detected in | rat eye tissue, mouse kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse kidney tissue |
| Positive IF/ICC detected in | HEK-293 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below |
| WB | See 10 publications below |
| IF | See 4 publications below |
Product Information
13947-1-AP targets GPX3 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, chicken |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag5054 Product name: Recombinant human GPX3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-72 aa of BC050378 Sequence: MARLLQASCLLSLLLAGFVSQSRGQEKSKMDCHGGISGTIYEYGALTIDGEEYIPFKQYAGKYVLFVNVASY Predict reactive species |
| Full Name | glutathione peroxidase 3 (plasma) |
| Calculated Molecular Weight | 226 aa, 26 kDa |
| Observed Molecular Weight | 20-27 kDa |
| GenBank Accession Number | BC050378 |
| Gene Symbol | GPX3 |
| Gene ID (NCBI) | 2878 |
| RRID | AB_3085426 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P22352 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
GPX3 (glutathione peroxidase 3) is also named as Plasma Glutathione Peroxidase. GPX3 can protects cells and enzymes from oxidative damage, by catalyzing the reduction of hydrogen peroxide, lipid peroxides and organic hydroperoxide, by glutathione. GPX3 is secreted into plasma and like GPX1, is an 100 kDa homotetramer consisting of four identical 23 kDa subunits, each containing a selenocysteine residue at the active site. It can be detected a band of 20 kDa which is considered as the chain A of GPX3 (selenocysteine to glycine mutant).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for GPX3 antibody 13947-1-AP | Download protocol |
| IHC protocol for GPX3 antibody 13947-1-AP | Download protocol |
| WB protocol for GPX3 antibody 13947-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Mol Ther Single-Cell Transcriptome Analysis Reveals Intratumoral Heterogeneity in ccRCC, which Results in Different Clinical Outcomes. | ||
Theranostics TFE3, a potential therapeutic target for Spinal Cord Injury via augmenting autophagy flux and alleviating ER stress. | ||
Bioorg Chem Two resveratrol analogs, pinosylvin and 4,4'-dihydroxystilbene, improve oligoasthenospermia in a mouse model by attenuating oxidative stress via the Nrf2-ARE pathway. | ||
Sci Rep Selenocysteine insertion sequence binding protein 2 (Sbp2) in the sex-specific regulation of selenoprotein gene expression in mouse pancreatic islets. | ||
J Cell Physiol Effect of Gpx3 gene silencing by siRNA on apoptosis and autophagy in chicken cardiomyocytes.
|

















