Tested Applications
| Positive WB detected in | K-562 cells, HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below |
Product Information
16005-1-AP targets GTF2H2 in WB, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag8653 Product name: Recombinant human GTF2H2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-165 aa of BC005345 Sequence: MDEEPERTKRWEGGYERTWEILKEDESGSLKATIEDILFKAKRKRVFEHHGQVRLGMMRHLYVVVDGSRTMEDQDLKPNRLTCTLKLLEYFVEEYFDQNPISQIGIIVTKSKRAEKLTELSGNPRKHITSLKKAVDMTCHGEPSLYNSLSIAMQTLKLVLYIMYN Predict reactive species |
| Full Name | general transcription factor IIH, polypeptide 2, 44kDa |
| Calculated Molecular Weight | 395aa,44 kDa; 165aa,19 kDa |
| Observed Molecular Weight | 44 kDa |
| GenBank Accession Number | BC005345 |
| Gene Symbol | GTF2H2 |
| Gene ID (NCBI) | 2966 |
| RRID | AB_2279415 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q13888 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Transcription factor IIH(TFIIH) is associated with the RNA polymerase II transcription complex, which is involved in transcription and transcription-mediated DNA repair. GTF2H2(GENERAL TRANSCRIPTION FACTOR IIH, POLYPEPTIDE 2) is one of the six subnuits forming the core-TFIIH basal transcriptional factor. TFIIH plays a role in nucleotide excision repair (NER) of DNA and, when complexed to CAK, in RNA transcription by RNA polymerase II. The N terminus of GTF2H2 interacts with and regulates XPD, and an intact C terminus is required for a successful escape of RNAPol II from the promoter. This is a rabbit polyclonal antibody producted by part of N-terminal GTF2H2 of human origin.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for GTF2H2 antibody 16005-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |







