Tested Applications
| Positive WB detected in | mouse testis tissue, A549 cells, NCI-H1299 cells, rat testis tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:3000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
19929-1-AP targets HEY1 in WB, IHC, IF, IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag13906 Product name: Recombinant human HEY1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 155-295 aa of BC001873 Sequence: VSHLNNYASQREAASGAHAGLGHIPWGTVFGHHPHIAHPLLLPQNGHGNAGTTASPTEPHHQGRLGSAHPEAPALRAPPSGSLGPVLPVVTSASKLSPPLLSSVASLSAFPFSFGSFHLLSPNALSPSAPTQAANLGKPYR Predict reactive species |
| Full Name | hairy/enhancer-of-split related with YRPW motif 1 |
| Calculated Molecular Weight | 304 aa, 33 kDa |
| Observed Molecular Weight | 32-34 kDa |
| GenBank Accession Number | BC001873 |
| Gene Symbol | HEY1 |
| Gene ID (NCBI) | 23462 |
| RRID | AB_10646438 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9Y5J3 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Hairy/enhancer of split-related proteins are basic helix-loop-helix (bHLH) transcription factors implicated in cell fate decision and boundary formation. And HEY1 is one of such protein. It is the direct downstream effector of Notch signaling which may be required for cardiovascular development. It preferentially bind to the canonical E box sequence 5'-CACGTG-3' and acts as a transcriptional repressor. HEY1 is a 33kDa protein and forms dimer by self-associating.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for HEY1 antibody 19929-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Metab Nicotinamide metabolism face-off between macrophages and fibroblasts manipulates the microenvironment in gastric cancer | ||
Protein Cell Microbiota enterotoxigenic Bacteroides fragilis-secreted BFT-1 promotes breast cancer cell stemness and chemoresistance through its functional receptor NOD1 | ||
Theranostics Nicotinamide mononucleotide enhances fracture healing by promoting skeletal stem cell proliferation | ||
J Exp Clin Cancer Res ACTN1 promotes HNSCC tumorigenesis and cisplatin resistance by enhancing MYH9-dependent degradation of GSK-3β and integrin β1-mediated phosphorylation of FAK | ||
Dev Cell Regulation of reverse electron transfer at mitochondrial complex I by unconventional Notch action in cancer stem cells. | ||
Nat Commun Cathepsin K-mediated notch1 activation contributes to neovascularization in response to hypoxia. |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Zhenminm (Verified Customer) (07-10-2019) | It is too much non-specific background.
![]() |




