Tested Applications
Positive WB detected in | Jurkat cells, mouse brain tissue, rat brain tissue, rat lung tissue |
Positive IP detected in | Jurkat cells |
Positive IHC detected in | human liver cancer tissue, human prostate cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:6000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 104 publications below |
IHC | See 3 publications below |
IF | See 3 publications below |
IP | See 2 publications below |
CoIP | See 1 publications below |
Product Information
15649-1-AP targets IKKB in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse, rat, pig, bovine |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag8191 Product name: Recombinant human IKBKB protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-256 aa of BC006231 Sequence: MSWSPSLTTQTCGAWEMKERLGTGGFGNVIRWHNQETGEQIAIKQCRQELSPRNRERWCLEIQIMRRLTHPNVVAARDVPEGMQNLAPNDLPLLAMEYCQGGDLRKYLNQFENCCGLREGAILTLLSDIASALRYLHENRIIHRDLKPENIVLQQGEQRLIHKIIDLGYAKELDQGSLCTSFVGTLQYLAPELLEQQKYTVTVDYWSFGTLAFECITGFRPFLPNWQPVQCVRMWPGTVAHSCNPSTLGGRGRWIS Predict reactive species |
Full Name | inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase beta |
Calculated Molecular Weight | 756aa,81 kDa; 256aa,29 kDa |
Observed Molecular Weight | 80 kDa, 86 kDa, 87 and 29 kDa |
GenBank Accession Number | BC006231 |
Gene Symbol | IKBKB |
Gene ID (NCBI) | 3551 |
RRID | AB_2122307 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | O14920 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
IKBKB, also named as IKKB, IKK2, NFKBIKB and IKK-B, belongs to the protein kinase superfamily, Ser/Thr protein kinase family and I-kappa-B kinase subfamily. IKBKB is a Serine kinase that plays an essential role in the NF-kappa-B signaling pathway. It acts as part of the canonical IKK complex in the conventional pathway of NF-kappa-B activation and phosphorylates inhibitors of NF-kappa-B on 2 critical serine residues. In addition to the NF-kappa-B inhibitors, IKBKB phosphorylates several other components of the signaling pathway including NEMO/IKBKG, NF-kappa-B subunits RELA and NFKB1, as well as IKK-related kinases TBK1 and IKBKE. It also phosphorylates other substrates including NCOA3, BCL10 and IRS1. Within the nucleus, IKBKB acts as an adapter protein for NFKBIA degradation in UV-induced NF-kappa-B activation. This antibody can identify 4 isoform of IKBKB with the molecular weight of 80, 86, 87 and 29 kDa.
Protocols
Product Specific Protocols | |
---|---|
IHC protocol for IKKB antibody 15649-1-AP | Download protocol |
IP protocol for IKKB antibody 15649-1-AP | Download protocol |
WB protocol for IKKB antibody 15649-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Nat Commun Hypothalamic SLC7A14 accounts for aging-reduced lipolysis in white adipose tissue of male mice | ||
Adv Sci (Weinh) Sirtuin 5-Mediated Desuccinylation of ALDH2 Alleviates Mitochondrial Oxidative Stress Following Acetaminophen-Induced Acute Liver Injury | ||
Drug Des Devel Ther Sichen Formula Ameliorates Lipopolysaccharide-Induced Acute Lung Injury via Blocking the TLR4 Signaling Pathways | ||
Cell Death Discov tRNA-derived fragment TRF365 regulates the metabolism of anterior cruciate ligament cells by targeting IKBKB. | ||
Redox Biol Cardioprotection of CAPE-oNO2 against myocardial ischemia/reperfusion induced ROS generation via regulating the SIRT1/eNOS/NF-κB pathway in vivo and in vitro. | ||
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Eugenia (Verified Customer) (03-16-2022) | Antibody worked well with specific band although a couple of non-specific bands also appeared.
|