Tested Applications
| Positive WB detected in | Calu-1 cells, A549 cells, HeLa cells, human brain tissue, MCF-7 cells, IFN alpha treated A459 cells, HepG2 cells, IFN alpha treated HepG2 cells, L02 cells, MDA-MB-231 cells, PC-3 cells |
| Positive IHC detected in | human lung cancer tissue, human pancreas cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
15981-1-AP targets ISG15 in WB, IHC, IF/ICC, IP, CoIP, RIP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, pig, monkey, chicken, goat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag8782 Product name: Recombinant human ISG15 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-165 aa of BC009507 Sequence: MGWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLNILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGGGTEPGGRS Predict reactive species |
| Full Name | ISG15 ubiquitin-like modifier |
| Calculated Molecular Weight | 165 aa, 18 kDa |
| Observed Molecular Weight | 15-17 kDa |
| GenBank Accession Number | BC009507 |
| Gene Symbol | ISG15 |
| Gene ID (NCBI) | 9636 |
| RRID | AB_2126302 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P05161 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ISG15 is a ubiquitin-like protein that becomes conjugated to many cellular proteins upon activation by interferon-alpha (IFNA) and -beta (IFNB). ISG15 forms covalent conjugates with its target proteins in a process called ISGylation, which in mammals is known to play a role in antiviral immunity. ISG15 proteins possess two ubiquitin-like (UBL) domains and a highly conserved C-terminal LRGG sequence, the latter being known as the ubiquitin conjugation motif. Intracellular ISG15 are conjugated, via the LRGG motif, to target proteins through a process called ISGylation, which resembles largely ubiquitination, the process of formation of ubiquitin conjugates. Unconjugated extracellular ISG15, which are released from several types of human and murine cells, are known to possess cytokine-like activity.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for ISG15 antibody 15981-1-AP | Download protocol |
| IHC protocol for ISG15 antibody 15981-1-AP | Download protocol |
| WB protocol for ISG15 antibody 15981-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
| Species | Application | Title |
|---|---|---|
Signal Transduct Target Ther TRAF3 activates STING-mediated suppression of EV-A71 and target of viral evasion | ||
Cell Metab Arachidonic acid triggers spermidine synthase secretion from primary tumor to induce skeletal muscle weakness upon irradiation | ||
Immunity A type I interferon-mitochondrial axis regulates efferocytosis and interferon-stimulated gene induction in macrophages.
| ||
Cell Host Microbe The bacterial effector GarD shields Chlamydia trachomatis inclusions from RNF213-mediated ubiquitylation and destruction | ||
Cell Host Microbe Innate immune sensing of rotavirus by intestinal epithelial cells leads to diarrhea | ||
Cancer Res ISG15 is a critical microenvironmental factor for pancreatic cancer stem cells. |
Reviews
What customers say
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Tinne (Verified Customer) (06-27-2023) | This antibody worked really well for detecting an up regulation of ISG15 in IF. Highly recommend!
|
Chaohui (Verified Customer) (10-19-2021) | The antibody shows a high quality of free ISG15 and conjugated ISG15 spots
|



















