Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

JAK1 Monoclonal antibody

JAK1 Monoclonal Antibody for WB, IHC, ELISA

Cat No. 66466-1-Ig
Clone No. 3H7A8
Publications (136)
Reviews (2)
Download datasheet

Host / Isotype

Mouse / IgG2b

Reactivity

human, rat, mouse

Applications

WB, IHC, IF, IP, CoIP, ELISA

JAK 1, JAK1, JAK1A, JAK1B, Janus kinase 1, JTK3, Tyrosine protein kinase JAK1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for JAK1 in ?

Tested Applications

Positive WB detected inK-562 cells, Jurkat cells, rat spleen tissue, PC-12 cells, NIH/3T3 cells, RAW 264.7 cells, Ramos cells, Daudi cells
Positive IHC detected inhuman breast cancer tissue, human cervical cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunohistochemistry (IHC)IHC : 1:100-1:400
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66466-1-Ig targets JAK1 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, rat, mouse samples.

Tested Reactivity human, rat, mouse
Cited Reactivityhuman, mouse, rat
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag17940

Product name: Recombinant human JAK1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 8-363 aa of BC132729

Sequence: EDCNAMAFCAKMRSSKKTEVNLEAPEPGVEVIFYLSDREPLRLGSGEYTAEELCIRAAQACRISPLCHNLFALYDENTKLWYAPNRTITVDDKMSLRLHYRMRFYFTNWHGTNDNEQSVWRHSPKKQKNGYEKKKIPDATPLLDASSLEYLFAQGQYDLVKCLAPIRDPKTEQDGHDIENECLGMAVLAISHYAMMKKMQLPELPKDISYKRYIPETLNKSIRQRNLLTRMRINNVFKDFLKEFNNKTICDSSVSTHDLKVKYLATLETLTKHYGAEIFETSMLLISSENEMNWFHSNDGGNVLYYEVMVTGNLGIQWRHKPNVVSVEKEKNKLKRKKLENKHKKDEEKNKIREEW

Predict reactive species
Full Name Janus kinase 1 (a protein tyrosine kinase)
Calculated Molecular Weight 1154 aa, 133 kDa
Observed Molecular Weight 133 kDa
GenBank Accession NumberBC132729
Gene Symbol JAK1
Gene ID (NCBI) 3716
RRIDAB_2881834
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP23458
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Janus kinase 1(JAK1), is a member of a class of protein-tyrosine kinases (PTK) characterized by the presence of a second phosphotransferase-related domain immediately N-terminal to the PTK domain. JAK1 is essential for signaling for certain type I and type II cytokines. JAK1 plays a critical role in initiating responses to multiple major cytokine receptor families. Expression of JAK1 in cancer cells enables individual cells to contract, potentially allowing them to escape their tumor and metastasize to other parts of the body.

Protocols

Product Specific Protocols
IHC protocol for JAK1 antibody 66466-1-IgDownload protocol
WB protocol for JAK1 antibody 66466-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The JAK1 Monoclonal antibody (3H7A8), catalog number 66466-1-Ig, has been cited in 136 publications. Citations appear in high-impact journals such as Cell, Nature Communications, Science Advances, Advanced Science, Cell Reports, Developmental Cell, Journal of Medicinal Chemistry, and International Journal of Biological Sciences, among many others. Associated research fields include oncology, immunology and inflammation, JAK/STAT signaling, pharmacology and drug discovery, neurology, hepatology, and dermatology.

SpeciesApplicationTitle
mouseWB

Signal Transduct Target Ther

Cannabis suppresses antitumor immunity by inhibiting JAK/STAT signaling in T cells through CNR2.

Authors - Xinxin Xiong
humanWB

Cell

Gasdermin E couples viral pyroptosis to lethal hepatic lipid accumulation

Authors - Chaojie Wang
humanWB,IP

Cell Mol Immunol

SENP6 restricts the IFN-I-induced signaling pathway and antiviral activity by deSUMOylating USP8

Authors - Jing Guo
human,mouseWB

Mol Neurodegener

Inflammatory signaling differentially changes chromatin accessibility and gene expression of the PD- associated kinase LRRK2 between human and mice.

Authors - Alexandra Beilina
humanWB

Nat Commun

Proteome-wide ligandability maps of drugs with diverse cysteine-reactive chemotypes

Authors - Caiping Tian
human, mouseWB,IP,IHC,IF

Cardiovasc Diabetol

Targeting TFAM K76 acetylation attenuates mitochondrial dysfunction and kidney injury in diabetic kidney disease.

Authors - Tingting Fu

Reviews

    4.5 out of 5
Add a review

2 verified customer reviews

What customers say

Both reviews are for Western Blot applications at a 1:1000 dilution. One user reported great results on human cancer cells. The other confirmed the signal appeared at the expected molecular weight with very low non-specific staining and proportional signal intensity to lysate loading in RPE1 and Huh7 cells, though noted that a relatively large amount of lysate is required for optimal detection. Overall, users find this antibody reliable with clean, specific results for WB.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Jimmy (Verified Customer) (05-28-2025)

Great results for western blot

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: human cancer cells

Christine (Verified Customer) (07-12-2022)

Signal is at the expected molecular weight, very low aspecific staining on the membrane, signal is proportional to the lysate quantity loaded. Need quite a large quantity of lysates.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: RPE1 cells and Huh7 cells (human)
JAK1 Antibody Western Blot validation (1:1000 dilution) in RPE1 cells and Huh7 cells (human) (Cat no:66466-1-Ig)
Loading...
||
New chat

Able™

正在加载,请稍候...