Filter: AllWBIPIHCIF/ICC

WB analysis of HeLa using 10424-1-AP
WB result of JTV1 antibody (10424-1-AP; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-JTV1 transfected HeLa cells.
WB analysis using 10424-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 10424-1-AP (JTV1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.
WB analysis of HeLa using 10424-1-AP
HeLa cells were subjected to SDS PAGE followed by western blot with 10424-1-AP (JTV1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
WB analysis of rat liver using 10424-1-AP
rat liver tissue were subjected to SDS PAGE followed by western blot with 10424-1-AP (JTV1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
WB analysis of NIH/3T3 using 10424-1-AP
NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 10424-1-AP (JTV1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
WB analysis of K-562 using 10424-1-AP
K-562 cells were subjected to SDS PAGE followed by western blot with 10424-1-AP (JTV1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
IP experiment of HeLa using 10424-1-AP
IP result of anti-JTV1 (IP:10424-1-AP, 3ug; Detection:10424-1-AP 1:1000) with HeLa cells lysate 800ug.
IHC staining of mouse cerebellum using 10424-1-AP
Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 10424-1-AP (JTV1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of mouse cerebellum using 10424-1-AP
Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 10424-1-AP (JTV1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human kidney using 10424-1-AP
Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 10424-1-AP (JTV1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human kidney using 10424-1-AP
Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 10424-1-AP (JTV1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of mouse testis using 10424-1-AP
Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 10424-1-AP (JTV1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of mouse testis using 10424-1-AP
Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 10424-1-AP (JTV1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IF Staining of HeLa using 10424-1-AP
Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using JTV1 antibody (10424-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002).
IF Staining of HepG2 using 10424-1-AP
Immunofluorescent analysis of HepG2 cells, using JTV1 antibody 10424-1-AP at 1:50 dilution and Rhodamine-labeled goat anti-rabbit IgG (red).

Featured Product
KD/KO Validated

JTV1 Polyclonal antibody

Name: JTV1 Polyclonal antibody
Brand: Proteintech
SKU: 10424-1-AP
Rating: 5.00 (1 reviews)

JTV1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 10424-1-AP

Publications(29)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

Synonyms

Protein JTV-1, PRO0992, P38, HLD17, Aminoacyl tRNA synthase complex-interacting multifunctional protein 2

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information
Publications (29)
Protocols
Reviews (1)

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	HepG2 cells, HeLa cells, K-562 cells, NIH/3T3 cells, rat liver tissue, L02 cells
Positive IP detected in	HeLa cells
Positive IHC detected in	mouse cerebellum tissue, human kidney tissue, mouse testis tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***
Positive IF/ICC detected in	HeLa cells, HepG2 cells

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:1000-1:8000
Immunoprecipitation (IP)	IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)	IHC : 1:50-1:500
Immunofluorescence (IF)/ICC	IF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

KD/KO	See 4 publications below
WB	See 26 publications below
IHC	See 3 publications below
IF	See 8 publications below
IP	See 2 publications below
CoIP	See 3 publications below

Product Information

10424-1-AP targets JTV1 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Cited Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag0675 Product name: Recombinant human JTV1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-200 aa of BC002853 Sequence: MPMYQVKPYHGGGAPLRVELPTCMYRLPNVHGRSYGPAPGAGHVQEESNLSLQALESRQDDILKRLYELKAAVDGLSKMIQTPDADLDVTNIIQADEPTTLTTNALDLNSVLGKDYGALKDIVINANPASPPLSLLVLHRLLCEHFRVLSTVHTHSSVKSVPENLLKCFGEQNKKQPRQDYQLGFTLIWKNVPKTQMKFS Predict reactive species
Full Name	JTV1 gene
Calculated Molecular Weight	36 kDa
Observed Molecular Weight	35 kDa
GenBank Accession Number	BC002853
Gene Symbol	JTV1
Gene ID (NCBI)	7965
RRID	AB_513880
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q13155
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

JTV1, also named p38, AIMP2, was first knew as a factor associated with macromolecular protein complex, which consists several different aminoacyl-tRNA synthetases. JTV1 is a scaffold protein required for the assembly and stability of the multi-tRNA synthetase complex. JTV1 could act as a mediator of TGF-beta signaling and its functional importance in the control of MYC during lung differentiation. Blocks MDM2-mediated ubiquitination and degradation of p53/TP53. Functions as a proapoptotic factor. This is a rabbit polyclonal antibody raised against full-length of JTV1. There're two isoforms of JTV1 with MW about 27 kDa and 35 kDa,

Protocols

Product Specific Protocols
IF protocol for JTV1 antibody 10424-1-AP	Download protocol
IHC protocol for JTV1 antibody 10424-1-AP	Download protocol
IP protocol for JTV1 antibody 10424-1-AP	Download protocol
WB protocol for JTV1 antibody 10424-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

Species	Application	Title
human	WB	Nature Global landscape of HIV-human protein complexes. Authors - Stefanie Jäger View Article
human	WB,IP	Mol Cell A methyltransferase-independent role for METTL1 in tRNA aminoacylation and oncogenic transformation Authors - Raja H Ali View Article
mouse	WB,IF	Nat Neurosci Parthanatos mediates AIMP2-activated age-dependent dopaminergic neuronal loss. Authors - Lee Yunjong Y View Article
human	WB	J Exp Clin Cancer Res RNA-binding protein CCDC137 activates AKT signaling and promotes hepatocellular carcinoma through a novel non-canonical role of DGCR8 in mRNA localization Authors - Shuang Tao View Article
human	WB,IF	Nat Commun Molecular determinants of selective clearance of protein inclusions by autophagy. Authors - Wong Esther E View Article
mouse	WB	Proc Natl Acad Sci U S A Role for the obesity-related FTO gene in the cellular sensing of amino acids. Authors - Gulati Pawan P View Article