Tested Applications
| Positive WB detected in | HeLa cells, COLO 320 cells, HEK-293 cells, fetal human brain tissue, HepG2 cells, A549 cells, human milk tissue, human plasma tissue |
| Positive IP detected in | HepG2 cells, HEK-293 cells |
| Positive IHC detected in | human oesophagus cancer tissue, human breast cancer tissue, human colon cancer, human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10281-1-AP targets LGALS3BP in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, pig, monkey |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0294 Product name: Recombinant human LGALS3BP protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 6-221 aa of BC002403 Sequence: LFWVWLLVAGTQGVNDGDMRLADGGATNQGRVEIFYRGQWGTVCDNLWDLTDASVVCRALGFENATQALGRAAFGQGSGPIMLDEVQCTGTEASLADCKSLGWLKSNCRHERDAGVVCTNETRSTHTLDLSRELSEALGQIFDSQRGCDLSISVNVQGEDALGFCGHTVILTANLEAQALWKEPGSNVTMSVDAECVPMVRDLLRYFYSRRIDITL Predict reactive species |
| Full Name | lectin, galactoside-binding, soluble, 3 binding protein |
| Calculated Molecular Weight | 585 aa, 65 kDa |
| Observed Molecular Weight | 65-90 kDa |
| GenBank Accession Number | BC002403 |
| Gene Symbol | LGALS3BP |
| Gene ID (NCBI) | 3959 |
| RRID | AB_2137066 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q08380 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. Galectin-3-binding protein (LGALS3BP, also known as 90K or Mac-2 BP) is a secreted glycoprotein which binds galectin-3, galectin-1, beta1 integrins, collagens and fibronectin (PMID: 8034587; 8024581; 11146440; 9501082). It has been implicated in tumor metastatic processes, as well as in other cell adhesion and immune functions. Levels of LGALS3BP have been found elevated in the serum of patients with cancer and in those infected by the human immunodeficiency virus (HIV) (PMID: 7698018). Western analysis suggests that LGALS3BP is found in breast milk, semen, saliva, urine, and tears, in addition to serum (PMID: 8390986 ).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for LGALS3BP antibody 10281-1-AP | Download protocol |
| IHC protocol for LGALS3BP antibody 10281-1-AP | Download protocol |
| IP protocol for LGALS3BP antibody 10281-1-AP | Download protocol |
| WB protocol for LGALS3BP antibody 10281-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
10281-1-AP is an anti-LGALS3BP (Galectin-3-binding protein) antibody with 27 total citations. Citations appear in journals including Cell, Nature Communications, Science Advances, Cancer Research, Blood Advances, Atherosclerosis, Molecular & Cellular Proteomics, Breast Cancer Research, PLoS Pathogens, Scientific Reports, Cancer Science, Cell Signaling, iScience, Veterinary Research, Frontiers in Oncology, and others. Research fields span cancer biology (breast, lung, oral, esophageal, colorectal, thyroid, glioma), innate immunity, proteomics/secretomics, cardiovascular disease, hematology, virology, and liver regeneration.
| Species | Application | Title |
|---|---|---|
Cell snoRNA-facilitated protein secretion revealed by transcriptome-wide snoRNA target identification | ||
Cancer Res A galectin-3-dependent pathway upregulates interleukin-6 in the microenvironment of human neuroblastoma.
| ||
Nat Commun Spatial proteomics reveals secretory pathway disturbances caused by neuropathy-associated TECPR2 | ||
Nat Commun Interactome analysis reveals that lncRNA HULC promotes aerobic glycolysis through LDHA and PKM2. | ||
Blood Adv Increased Mac-2 binding protein glycan isomer in patients at risk for late nonrelapse mortality after HSCT. |
Reviews
What customers say
Both reviewers rated this antibody 5 stars for Western Blot. One user (LNCaP cells, 1:1000 dilution) described it as a "beautiful antibody" that produces a single band at the correct size. The other reviewer also gave it a perfect score without additional comments. Overall, users report clean, specific results with this antibody in WB applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Shriya (Verified Customer) (10-28-2025) |
|
Emma (Verified Customer) (03-15-2022) | Beautiful antibody - produces a single band at the correct size.
|
