Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

LIN28A Polyclonal antibody

LIN28A Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, IP, RIP, ELISA

Protein lin 28 homolog A, Lin-28A, LIN28, Lin 28A, LIN 28

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for LIN28A in ?

Tested Applications

Positive WB detected inK-562 cells, NCCIT cells, mouse embryo tissue
Positive IP detected inK-562 cells
Positive IHC detected inmouse testis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inhuman embronic stem cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:8000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:20-1:200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

11724-1-AP targets LIN28A in WB, IHC, IF/ICC, IP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, canine
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag2312

Product name: Recombinant human LIN28 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-209 aa of BC028566

Sequence: MGSVSNQQFAGGCAKAAEEAPEEAPEDAARAADEPQLLHGAGICKWFNVRMGFGFLSMTARAGVALDPPVDVFVHQSKLHMEGFRSLKEGEAVEFTFKKSAKGLESIRVTGPGGVFCIGSERRPKGKSMQKRRSKGDRCYNCGGLDHHAKECKLPPQPKKCHFCQSISHMVASCPLKAQQGPSAQGKPTYFREEEEEIHSPTLLPEAQN

Predict reactive species
Full Name lin-28 homolog (C. elegans)
Calculated Molecular Weight 209 aa, 23 kDa
Observed Molecular Weight 28 kDa
GenBank Accession NumberBC028566
Gene Symbol LIN28
Gene ID (NCBI) 79727
RRIDAB_2135039
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9H9Z2
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

LIN28 is one of the four key human factors (OCT4, SOX2, NANOG and LIN28) used to reprogram human fibroblasts to an embryonic stem (ES) cell-like state known as the induced pluripotent stem (Ips) cell[PMID: 20139967]. LIN28 is a marker of undifferentiated human embryonic stem cells and a cytoplasmic mRNA-binding protein that binds to and enhances the translation of the IGF2 mRNA[PMID: 21057460]. LIN28 has also been shown to bind to the let-7 pre-miRNA and block production of the mature let-7 microRNA in mouse embryonic stem cells[PMID: 22078496]. Affinity purified rabbit anti-LIN28 can be used to demonstrate pluripotency of ES and Ips cells, and to detect LIN28 transgene expression in the process of reprogramming. This antibody is a rabbit polyclonal antibody raised against full length LIN28 of human origin. The calculated molecular weight of LIN28 is 23 kDa, but the modified LIN28 is about 28 kDa.

Protocols

Product Specific Protocols
IHC protocol for LIN28A antibody 11724-1-APDownload protocol
IP protocol for LIN28A antibody 11724-1-APDownload protocol
WB protocol for LIN28A antibody 11724-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

LIN28 antibody (Cat# 11724-1-AP) has 64 citations published in journals including Nature, Nature Genetics, Cell Research, Nature Methods, PNAS, Cancer Research, Cell Reports, and Nucleic Acids Research. Associated research fields span oncology (gastric, breast, prostate, germ cell, and oral cancers), stem cell biology (iPSC generation, pluripotency), RNA/microRNA regulation (Lin28/let-7 axis), neuroscience, reproductive biology, and immunology.

SpeciesApplicationTitle
mouseIHC

Nature

A role for Lin28 in primordial germ-cell development and germ-cell malignancy.

Authors - West Jason A JA
humanWB, IF

Mol Cancer

The lncRNA MACC1-AS1 promotes gastric cancer cell metabolic plasticity via AMPK/Lin28 mediated mRNA stability of MACC1.

Authors - Yang Zhao
mouseIHC

Cell Res

Ythdc2 is an N(6)-methyladenosine binding protein that regulates mammalian spermatogenesis.

Authors - Phillip J Hsu
humanWB,IF

Nat Methods

A nonviral minicircle vector for deriving human iPS cells.

Authors - Jia Fangjun F
human,mouseWB,IHC

Nat Genet

Lin28 promotes transformation and is associated with advanced human malignancies.

Authors - Viswanathan Srinivas R SR
mouseIHC

Nat Genet

Lin28a transgenic mice manifest size and puberty phenotypes identified in human genetic association studies.

Authors - Zhu Hao H
Loading...
||
New chat

Able™

正在加载,请稍候...