Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

MCL1 Polyclonal antibody

MCL1 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Cat No. 16225-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA, PLA

Bcl2-L-3, Bcl-2-like protein 3, Bcl-2-related protein EAT/mcl1, EAT, Induced myeloid leukemia cell differentiation protein Mcl-1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inJurkat cells, mouse spleen tissue, Raji cells, HL-60 cells, A431 cells, human liver tissue, HEK-293T cells, human brain tissue, K-562 cells, MCF-7 cells, HeLa cells
Positive IP detected inRaji cells
Positive IHC detected inhuman ovary cancer tissue, human colon cancer
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inMCF-7 cells
Positive FC (Intra) detected inRamos cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:8000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.50 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

16225-1-AP targets MCL1 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA, PLA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag10397

Product name: Recombinant human MCL1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-327 aa of BC107735

Sequence: MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGGGEAGAVIGGSAGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEGG

Predict reactive species
Full Name myeloid cell leukemia sequence 1 (BCL2-related)
Calculated Molecular Weight 350 aa, 37 kDa
Observed Molecular Weight 35-40 kDa
GenBank Accession NumberBC107735
Gene Symbol MCL1
Gene ID (NCBI) 4170
RRIDAB_2143977
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ07820
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MCL-1 is an anti-apoptotic member of the Bcl-2 family originally isolated from the ML-1 human myeloid leukemia cell line. Similar to BCL2 and BCL2L1, MCL1 can interact with BAX and/or BAK1 to inhibit mitochondria-mediated apoptosis. Mcl-1 is critical for the proliferation and survival of myeloma cells in vitro, and overexpression of Mcl-1 protein in myeloma cells is associated with relapse and short event-free survival in multiple myeloma patients. Recent studies show that MCL-1 is upregulated in numerous haematological and solid tumour malignancies. Therefore, MCL-1 has been suggested as a potential new therapeutic target. MCL-1 can be alternatively spliced into a long form (MCL-1L, 40 kDa) or a short form (MCL-1S, 30 kDa). (PMID: 15467463, PMID: 15147382)

Protocols

Product Specific Protocols
FC protocol for MCL1 antibody 16225-1-APDownload protocol
IF protocol for MCL1 antibody 16225-1-APDownload protocol
IHC protocol for MCL1 antibody 16225-1-APDownload protocol
IP protocol for MCL1 antibody 16225-1-APDownload protocol
WB protocol for MCL1 antibody 16225-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
mouseWB

Cell Metab

Muscle-derived small extracellular vesicles induce liver fibrosis during overtraining

Authors - Ya Liu
mouse,humanWB

Cancer Res

Bcl-xL enforces a slow-cycling state necessary for survival in the nutrient-deprived microenvironment of pancreatic cancer.

Authors - Yogev Sela
humanWB

Nat Commun

Small-molecule suppression of calpastatin degradation reduces neuropathology in models of Huntington's disease.

Authors - Di Hu

Nat Commun

Elucidating molecularly stratified single agent, and combination, therapeutic strategies targeting MCL1 for lethal prostate cancer

Authors - Juan M Jiménez-Vacas
mouseIHC

Nat Commun

MCL-1 gains occur with high frequency in lung adenocarcinoma and can be targeted therapeutically.

Authors - Enkhtsetseg Munkhbaatar
humanWB,IP

Nat Commun

USP9X regulates centrosome duplication and promotes breast carcinogenesis.

Authors - Xin Li

Reviews

    5.0 out of 5
Add a review

1 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Eya (Verified Customer) (07-06-2021)

the bands appear very clear

  • Applications: Western Blot
  • Primary Antibody Dilution: 1/1000
  • Cell Tissue Type: shTHP1
Loading...
||
New chat

Able™

正在加载,请稍候...