• Featured Product
  • KD/KO Validated

MYD88 Polyclonal antibody

MYD88 Polyclonal Antibody for WB, IP, ELISA
Cat No. 23230-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human and More (7)

Applications

WB, IHC, IF, IP, CoIP, ELISA

MYD88, MYD88D

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inJurkat cells, A549 cells, HepG2 cells, MCF-7 cells, K-562 cells, Raji cells
Positive IP detected inK-562 cells, A549 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

23230-1-AP targets MYD88 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, pig, canine, monkey, chicken, bovine, sheep, duck
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag19770

Product name: Recombinant human MYD88 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-150 aa of BC013589

Sequence: MAAGGPGAGSAAPVSSTSSLPLAALNMRVRRRLSLFLNVRTQVAADWTALAEEMDFEYLEIRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYILKQQQEEAEKPLQVAAVDSSVPRTAELAGITTL

Predict reactive species
Full Name myeloid differentiation primary response gene (88)
Calculated Molecular Weight 33 kDa
Observed Molecular Weight 33 kDa
GenBank Accession NumberBC013589
Gene Symbol MYD88
Gene ID (NCBI) 4615
RRIDAB_2879236
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ99836
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Myeloid differentiation primary response 88 (MYD88) is an adapter protein critical to the innate and adaptive immune response.

 What is the molecular weight of MYD88?

The molecular weight of MYD88 is 33 kDa.

 What is the cellular localization of MYD88?

The subcellular localization of MYD88 is largely confined to the cytoplasm as condensed forms or aggregated structures.

 What is the role of MYD88 in the IL-1R signaling pathway?

MYD88 plays a major role in the inflammatory signaling pathways downstream of Toll-like receptor (TLR) and interleukin-1 receptor (IL-1R) families. MYD88 links these receptors to IL-1R-associated kinases (IRAK), such as IRAK1 and IRAK2, via protein-protein interactions. The C-terminal TIR domain of MYD88 mediates the interaction with the receptors, whereas the N-terminal death domain of MYD88 associates with IRAK family members (PMID: 25580251). MYD88 acts via its intermediate domain to phosphorylate and thus activate IRAK1, IRAK2, IRF7, and TRAF6 to trigger NF-kappa-B signaling and cytokine secretion as part of the inflammatory response (PMID: 19679662).

 What is MYD88's involvement in disease?

Defects in MYD88 due to deficiency of the protein leads to recurrent pyogenic bacterial infections, including invasive pneumococcal disease. Patients usually die between 1 and 11 months of age, but surviving patients are otherwise healthy with normal resistance to other microbes (PMID: 18669862). Mutations in the MYD88 gene also lead to the development of cancers such as lymphoma (PMID: 21179087) and some autoimmune disorders like ulcerative colitis (PMID: 24189845).


Protocols

Product Specific Protocols
IP protocol for MYD88 antibody 23230-1-APDownload protocol
WB protocol for MYD88 antibody 23230-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
WB

Adv Mater

Manganese@Albumin Nanocomplex and Its Assembled Nanowire Activate TLR4-Dependent Signaling Cascades of Macrophages

Authors - Shuodan Huang
WB

Mol Cell

CPT1A induction following epigenetic perturbation promotes MAVS palmitoylation and activation to potentiate antitumor immunity

Authors - Guiheng Zhang
  • KO Validated
WB

Mol Cell

Serine synthesis sustains macrophage IL-1β production via NAD+-dependent protein acetylation

Authors - Chuanlong Wang
humanWB

Adv Sci (Weinh)

OR11H1 Missense Variant Confers the Susceptibility to Vogt-Koyanagi-Harada Disease by Mediating Gadd45g Expression

Authors - Xingran Li
humanWB

Gut Microbes

Fusobacterium nucleatum promotes esophageal squamous cell carcinoma progression and chemoresistance by enhancing the secretion of chemotherapy-induced senescence-associated secretory phenotype via activation of DNA damage response pathway

Authors - Jian-Wei Zhang
pigWB

Nucleic Acids Res

The N6-methyladenosine RNA-binding protein YTHDF1 modulates the translation of TRAF6 to mediate the intestinal immune response.

Authors - Xin Zong

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Rouba (Verified Customer) (07-05-2022)

Antibody was diluted to the 1/100 in blocking solution and incubated ON at 4 degrees celcius

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1/100
  • Cell Tissue Type: Myoblasts
MYD88 Antibody Immunofluorescence validation (1/100 dilution) in Myoblasts (Cat no:23230-1-AP)
FH

Cassand (Verified Customer) (10-22-2021)

Nice antibody works good.

  • Applications: Immunohistochemistry
  • Primary Antibody Dilution: 1:300
  • Cell Tissue Type: Gut
MYD88 Antibody Immunohistochemistry validation (1:300 dilution) in Gut (Cat no:23230-1-AP)
Loading...
||
New chat Able
正在加载,请稍候...