Tested Applications
| Positive WB detected in | mouse brain tissue, human heart tissue |
| Positive IHC detected in | human prostate cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 6 publications below |
| IHC | See 1 publications below |
| IF | See 2 publications below |
Product Information
16777-1-AP targets NEDD8 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, monkey samples.
| Tested Reactivity | human, mouse, rat, monkey |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag10154 Product name: Recombinant human NEDD8 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-81 aa of BC104664 Sequence: MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALRGGGGLRQ Predict reactive species |
| Full Name | neural precursor cell expressed, developmentally down-regulated 8 |
| Calculated Molecular Weight | 81 aa, 9 kDa |
| Observed Molecular Weight | 6-10 kDa |
| GenBank Accession Number | BC104664 |
| Gene Symbol | NEDD8 |
| Gene ID (NCBI) | 4738 |
| RRID | AB_10598467 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q15843 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
NEDD8 (neural precursor cell-expressed developmentally down-regulated gene 8) is a small ubiquitin-like protein that shares 60% sequence identity and 80% homology with ubiquitin [PMID:9353319]. NEDD8 is conjugated to substrate proteins in a process known as neddylation. NEDD8 forms a thioester bond with APPBP1-Uba3, the E1 enzyme. Activated NEDD8 then transfers to Ubc12, the E2 enzyme . Ultimately, E2 loaded with NEDD8 binds a substrate protein lysine residue and forms an isopeptide bond by E3 ligase [PMID:18802447].
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for NEDD8 antibody 16777-1-AP | Download protocol |
| WB protocol for NEDD8 antibody 16777-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nat Neurosci Identification of NUB1 as a suppressor of mutant Huntington toxicity via enhanced protein clearance. | ||
J Transl Med TC2N inhibits distant metastasis and stemness of breast cancer via blocking fatty acid synthesis | ||
Neuropsychopharmacology Synaptic control of DNA methylation involves activity-dependent degradation of DNMT3A1 in the nucleus.
| ||
J Med Chem Halo and Pseudohalo Gold(I)-NHC Complexes Derived from 4,5-Diarylimidazoles with Excellent in Vitro and in Vivo Anticancer Activity Against HCC. | ||
Front Bioeng Biotechnol Let-7i-5p Regulation of Cell Morphology and Migration Through Distinct Signaling Pathways in Normal and Pathogenic Urethral Fibroblasts. | ||
J Exp Clin Cancer Res Neddylation activated TRIM25 desensitizes triple-negative breast cancer to paclitaxel via TFEB-mediated autophagy |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Jose (Verified Customer) (09-14-2021) | Strong signal
|
