Tested Applications
| Positive WB detected in | Jurkat cells, Raji cells |
| Positive IHC detected in | human spleen tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
25350-1-AP targets NOX5 in WB, IHC, CoIP, ELISA, PLA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, pig, monkey |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag18673 Product name: Recombinant human NOX5 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 559-719 aa of BC125098 Sequence: YRHQKRKHTCPSCQHSWIEGVQDNMKLHKVDFIWINRDQRSFEWFVSLLTKLEMDQAEEAQYGRFLELHMYMTSALGKNDMKAIGLQMALDLLANKEKKDSITGLQTRTQPGRPDWSKVFQKVAAEKKGKVQVFFCGSPALAKVLKGHCEKFGFRFFQENF Predict reactive species |
| Full Name | NADPH oxidase, EF-hand calcium binding domain 5 |
| Calculated Molecular Weight | 765 aa, 86 kDa |
| Observed Molecular Weight | 82-86 kDa |
| GenBank Accession Number | BC125098 |
| Gene Symbol | NOX5 |
| Gene ID (NCBI) | 79400 |
| RRID | AB_2811208 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q96PH1 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
NOX5 (NADPH oxidase, EF-hand calcium binding domain 5) is an NADPH oxidase that generates superoxide and functions as an H+ channel in a Ca(2+)-dependent manner. It plays an important role in PDGF-induced JAK/STAT activation and human aortic smooth muscle cell (HASMC) proliferation. NOX5 is the main source of superoxide and is implicated in human spermatozoa motility. This protein has 6 isoforms produced by alternative splicing, named NOX5-α, -β, -γ, -δ, -ε and -ζ with the molecular mass of 84, 82, 86, 85, 64 and 83 kDa (PMID: 22427510 and Uniprot).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for NOX5 antibody 25350-1-AP | Download protocol |
| WB protocol for NOX5 antibody 25350-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
25350-1-AP is an anti-NOX5 antibody with 13 total citations. Citations appear in journals including Biomedical Pharmacotherapy, Free Radical Biology and Medicine, International Journal of Nanomedicine, International Journal of Oncology, Frontiers in Pharmacology, Frontiers in Cell and Developmental Biology, Neoplasia, Journal of Leukocyte Biology, Molecular Medicine Reports, International Journal of Molecular Sciences, Ecotoxicology and Environmental Safety, and Biochemical and Biophysical Research Communications. Research fields span oxidative stress, cancer therapy, diabetic complications, neurodegeneration, and renal fibrosis.
| Species | Application | Title |
|---|---|---|
Biomed Pharmacother Therapeutic effect of phycocyanin on acute liver oxidative damage caused by X-ray. | ||
Int J Nanomedicine Adipocyte-Derived Exosomal NOX4-Mediated Oxidative Damage Induces Premature Placental Senescence in Obese Pregnancy | ||
Free Radic Biol Med Nitric oxide and heme-NO stimulate superoxide production by NADPH oxidase 5. | ||
Free Radic Biol Med Chronic hypoxia of endothelial cells boosts HIF-1α-NLRP1 circuit in Alzheimer's disease | ||
Int J Oncol Polydatin, a potential NOX5 agonist, synergistically enhances antitumor activity of cisplatin by stimulating oxidative stress in non‑small cell lung cancer | ||
Ecotoxicol Environ Saf Disruption of mitochondrial redox homeostasis as a mechanism of antimony-induced reactive oxygen species and cytotoxicity. |
Reviews
What customers say
One reviewer (Samantha Richter, Nov 2025) gave a 5-star rating after using this antibody at a 1:2000 dilution in HEK cells for Western Blot, Immunofluorescence, and Immunoprecipitation. She reported success across all three applications but noted that performance may vary depending on the cell type used.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Samantha (Verified Customer) (11-06-2025) | we use this antibody for IP, IF, and western blot. We have success with all, but it just a heads up, does not work equally well for all cell types.
|
