Tested Applications
| Positive WB detected in | A431 cells, C6 cells, NIH/3T3 cells, Jurkat cells, A549 cells, HEK-293 cells, MCF-7 cells |
| Positive IP detected in | HEK-293 cells |
| Positive IHC detected in | human pancreas tissue, human testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
| Positive FC (Intra) detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10724-1-AP targets NRAS in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1081 Product name: Recombinant human NRAS protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-189 aa of BC005219 Sequence: MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQGCMGLPCVVM Predict reactive species |
| Full Name | neuroblastoma RAS viral (v-ras) oncogene homolog |
| Calculated Molecular Weight | 21 kDa |
| Observed Molecular Weight | 21 kDa |
| GenBank Accession Number | BC005219 |
| Gene Symbol | NRAS |
| Gene ID (NCBI) | 4893 |
| RRID | AB_2154209 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P01111 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Neuroblastoma rat sarcoma viral oncogene homolog (NRAS) was originally identified as the third RAS family member following KRAS and HRAS in human neuroblastoma and fibrosarcoma cell lines (PMID: 6572964). Akin to KRAS, NRAS encodes small GTP enzymes which regulate cell cycle, proliferation, maturation and differentiation by transducing signals from membrane-localized receptor tyrosine kinases to the nucleus. The mutation of RAS gene family occurs in nearly 30% of human cancers (PMID: 12509763). NRAS plays an important role in EGFR mediating RAS/RAF/MEK/ERK and PI3K/AKT/mTOR signaling pathways (PMID: 17297468). The mutation of NRAS leads to continuous activation of Ras-GTP, which promotes tumorigenesis and metastasis. It has been proved that NRAS acts as a negative prognosis predictor in numerous somatic malignancies, such as melanoma, colorectal cancer and hepatocellular carcinoma (PMID: 30685691, PMID: 30484984). Besides, NRAS, as a proto-oncogene, is also proved to be associated with tumor immune microenvironment (TIM) both in vivo and in vitro. NRAS GTPase is related to T-cell proliferation and immune response (PMID: 34746975). NRAS, also named as N-ras and NRAS1, is neuroblastoma RAS viral (v-ras) oncogene homolog from the mammalian ras gene family and it is a member of the small GTPase superfamily. RAS proteins are involved in signal transduction pathways, and bind GDP/GTP and possess intrinsic GTPase activity. It is mapped on chromosome 1, and it is activated in HL60, a promyelocytic leukemia line. Defects in NRAS are a cause of juvenile myelomonocytic leukemia (JMML).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for NRAS antibody 10724-1-AP | Download protocol |
| IF protocol for NRAS antibody 10724-1-AP | Download protocol |
| IHC protocol for NRAS antibody 10724-1-AP | Download protocol |
| IP protocol for NRAS antibody 10724-1-AP | Download protocol |
| WB protocol for NRAS antibody 10724-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The NRAS Polyclonal antibody (Cat# 10724-1-AP) has 50 citations spanning journals including Cell, Nature Communications, Nature Cell Biology, Cancer Research, PNAS, Oncogene, and Cell Chemical Biology. Research fields cover RAS signaling, oncology (melanoma, colorectal, pancreatic, hepatocellular, ovarian, and lung cancers), senescence, RNA biology, drug resistance mechanisms, immunotherapy, and fibrosis. Applications cited include WB, IHC, IF, and IP in human, mouse, and rat samples.
| Species | Application | Title |
|---|---|---|
Cell A non-canonical role for a small nucleolar RNA in ribosome biogenesis and senescence | ||
Nat Aging Nuclear export of R-loop by the DDX1 and XPO1 complex promotes senescence-associated secretory phenotype and inflammaging | ||
Gut RNA helicase DDX5 enables STAT1 mRNA translation and interferon signalling in hepatitis B virus replicating hepatocytes. | ||
Nat Cell Biol ADAR1 downregulation by autophagy drives senescence independently of RNA editing by enhancing p16INK4a levels. | ||
Cancer Res Combined Inhibition of HRAS and MEK Induces Tumor Regression and Restores Myogenic Differentiation in HRAS-Mutant Rhabdomyosarcoma. | ||
Cancer Res Blocking Nitrosylation Induces Immunogenic Cell Death by Sensitizing NRAS-Mutant Melanoma to MEK Inhibitors |
Reviews
What customers say
Users report mixed results with this antibody. One reviewer (WB, 1:1000) rated it 3/5, noting it is not entirely specific and cross-reacts with other Ras isoforms such as KRAS when used on HeLa cells. Another reviewer (IHC, 1:100) gave it 5/5, reporting excellent performance on mouse tissue from an inducible tumor model. Overall, the antibody performs well for IHC but may show limited specificity in Western blot applications where distinguishing between Ras family members is critical.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
RAFAEL (Verified Customer) (03-18-2026) | The antibody is not entirely specific, as it recognizes other Ras isoforms such as KRAS
 |
Brandon (Verified Customer) (11-27-2018) | Worked excellent on mouse tissue from inducible tumor model!
|
