Tested Applications
| Positive WB detected in | A375 cells, human spleen tissue, K-562 cells, mouse brain tissue, HT-29 cells, HuH-7 cells, Jurkat cells |
| Positive IHC detected in | human lung cancer tissue, human stomach cancer tissue, human stomach tissue, mouse kidney tissue, human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse small intestine tissue, human appendicitis tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:3000 |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
12231-1-AP targets CD73 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, bovine |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2869 Product name: Recombinant human NT5E,CD73 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 32-264 aa of BC015940 Sequence: LHTNDVHSRLEQTSEDSSKCVNASRCMGGVARLFTKVQQIRRAEPNVLLLDAGDQYQGTIWFTVYKGAEVAHFMNALRYDAMALGNHEFDNGVEGLIEPLLKEAKFPILSANIKAKGPLASQISGLYLPYKVLPVGDEVVGIVGYTSKETPFLSNPGTNLVFEDEITALQPEVDKLKTLNVNKIIALGHSGFEMDKLIAQKVRGVDVVVGGHSNTFLYTGNCFKRIAWARMSR Predict reactive species |
| Full Name | 5'-nucleotidase, ecto (CD73) |
| Calculated Molecular Weight | 29 kDa, 63 kDa |
| Observed Molecular Weight | 60-70 kDa |
| GenBank Accession Number | BC015940 |
| Gene Symbol | CD73 |
| Gene ID (NCBI) | 4907 |
| RRID | AB_2154081 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P21589 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
NT5E(5'-nucleotidase) is also named as NT5, NTE,CD73,ecto-5'-nucleotidase, and belongs to the 5'-nucleotidase family. It catalyzes the conversion at neutral pH of purine 5-prime mononucleotides to nucleosides, the preferred substrate being AMP.The enzyme occurs mainly as a dimer and the wide distribution of NT5E in the rat hippocampus, suggesting their involvement in the control of the purinergic signaling(PMID:17619139). This protein has two isoforms with the molecular weight of 63 kDa and 58 kDa and four glycosylation sites with a signalpeptide. It can exsit as a dimer(PMID:17619139). It can be detected the band of 55 kDa, 64 kDa, 70 kDa, 110 kDa by western blot(PMID:17619139; 12370277; 21533188). Defects in NT5E are the cause of calcification of joints and arteries (CALJA).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CD73 antibody 12231-1-AP | Download protocol |
| IHC protocol for CD73 antibody 12231-1-AP | Download protocol |
| WB protocol for CD73 antibody 12231-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The CD73 Polyclonal antibody (Cat# 12231-1-AP) has 76 citations across journals including Cell Metabolism, Nature Communications, Theranostics, Advanced Science, Biomaterials, International Journal of Biological Sciences, Frontiers in Immunology, and Biochemical and Biophysical Research Communications. Research fields span oncology (colorectal, pancreatic, gastric, lung, breast cancers), immunology (tumor microenvironment, immune checkpoints), liver fibrosis, bone/cartilage regeneration, cardiovascular disease, neuroscience, stem cell biology, and inflammation.
| Species | Application | Title |
|---|---|---|
Cell Metab Compartmentalized branched-chain amino acid metabolism orchestrates colorectal cancer dissemination via an UMP-vimentin axis. | ||
Nat Commun Dynamically cultured, differentiated bovine adipose-derived stem cell spheroids as building blocks for biofabricating cultured fat | ||
J Nanobiotechnology Mesenchymal stem cells, as glioma exosomal immunosuppressive signal multipliers, enhance MDSCs immunosuppressive activity through the miR-21/SP1/DNMT1 positive feedback loop | ||
Theranostics A sericin/ graphene oxide composite scaffold as a biomimetic extracellular matrix for structural and functional repair of calvarial bone. | ||
Theranostics GATA4-driven miR-206-3p signatures control orofacial bone development by regulating osteogenic and osteoclastic activity. |
Reviews
What customers say
Customer feedback for this antibody is mixed. One user rated it 4/5, describing it as a good product for immunocytochemistry at a 1:100 dilution on ROs. Another user gave it 1/5, reporting that staining did not work when used at 1:100 on fixed frozen mouse small intestine tissue for immunofluorescence. Overall, the antibody appears to perform well in cell-based applications but may require optimization for tissue sections.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Alessandro (Verified Customer) (12-09-2023) | good product for ICC
|
Neta (Verified Customer) (07-28-2022) | staining did not work
|
