Tested Applications
| Positive WB detected in | Jurkat cells, K-562 cells, mouse heart tissue |
| Positive IP detected in | K-562 cells |
| Positive IHC detected in | human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
14713-1-AP targets PEX19 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, arabidopsis |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag6434 Product name: Recombinant human PEX19 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-299 aa of BC000496 Sequence: MAAAEEGCSVGAEADRELEELLESALDDFDKAKPSPAPPSTTTAPDASGPQKRSPGDTAKDALFASQEKFFQELFDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDMTSQQEFTSCLKETLSGLAKNATDLQNSSMSEEELTKAMEGLGMDEGDGEGNILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESLPPEQFEKYQEQHSVMCKICEQFEAETPTDSETTQKARFEMVLDLMQQLQDLGHPPKELAGEMPPGLNFDLDALNLSGPPGASGEQCLIM Predict reactive species |
| Full Name | peroxisomal biogenesis factor 19 |
| Calculated Molecular Weight | 33 kDa |
| Observed Molecular Weight | 35-40 kDa |
| GenBank Accession Number | BC000496 |
| Gene Symbol | PEX19 |
| Gene ID (NCBI) | 5824 |
| RRID | AB_2162265 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P40855 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Peroxins (PEXs) are proteins that are essential for the assembly of functional peroxisomes. PEX19 gene is necessary for early peroxisomal biogenesis. It acts both as a cytosolic chaperone and as an import receptor for peroxisomal membrane proteins (PMPs) (PMID: 14709540). PEX19 may bind newly synthesized PMPs and facilitate their insertion into the peroxisome membrane (PMID: 107044440. The peroxisome biogenesis disorders (PBDs) are a group of genetically heterogeneous autosomal recessive, lethal diseases characterized by multiple defects in peroxisome function. Defects in this gene are a cause of Zellweger syndrome (ZWS), as well as peroxisome biogenesis disorder complementation group 14 (PBD-CG14) (PMID:20683989) (PMID:10051604).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for PEX19 antibody 14713-1-AP | Download protocol |
| IP protocol for PEX19 antibody 14713-1-AP | Download protocol |
| WB protocol for PEX19 antibody 14713-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The PEX19 polyclonal antibody (Cat# 14713-1-AP) has 20 total citations published in journals including Nature, Nature Communications, Cell Death & Differentiation, Developmental Cell, Current Biology, Journal of Cell Biology, and others. Research fields span peroxisome biogenesis, pexophagy, ferroptosis, lipid metabolism, mitochondrial quality control, oxidative stress adaptation, aging, and antiviral immunity, with applications primarily in Western blotting and immunofluorescence across human, mouse, and Arabidopsis models.
| Species | Application | Title |
|---|---|---|
Nat Commun A mitochondria-driven quality control mechanism for peroxisomal membrane proteins. | ||
Nat Commun Limited survival and impaired hepatic fasting metabolism in mice with constitutive Rag GTPase signaling. | ||
Cell Death Differ Peroxisome-driven ether-linked phospholipids biosynthesis is essential for ferroptosis. | ||
Cell Commun Signal TFEB activation triggers pexophagy for functional adaptation during oxidative stress under calcium deficient-conditions |
Reviews
What customers say
Both reviewers gave 5-star ratings for Western Blot. They consistently praised the antibody for producing clean results with no non-specific bands. One user tested it on recombinant human Pex19 at a 1:4000 dilution with milk/TBST blocking and detected ~60 ng of protein via ECL. The other used HEK293 lysates at 1:1000 with BSA/TBS blocking. Overall, users report high specificity and reliable performance in WB.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Susanne (Verified Customer) (07-03-2023) | very good in western blot, membrane blockes with milkpowder in TBST no non-specitif bands detection of ~60ng purified recomb. human Pex19 mit HRP-conjugated secondary antibody and ECL
 |
Tom (Verified Customer) (09-08-2021) | Very good antibody - no non-specific bands. Membrane blocked with BSA in TBS.
 |
