Filter: AllWBIHCIF/ICC

WB analysis of PC-3 using 12452-1-AP
PC-3 cells were subjected to SDS PAGE followed by western blot with 12452-1-AP (VPS34 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.
WB analysis of Jurkat using 12452-1-AP
WB result of VPS34 (C terminal) antibody (12452-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-VPS34 (C terminal) transfected Jurkat cells.
WB analysis of rat brain using 12452-1-AP
rat brain tissue were subjected to SDS PAGE followed by western blot with 12452-1-AP (VPS34 antibody at dilution of 1:600 incubated at room temperature for 1.5 hours.
WB analysis of human testis using 12452-1-AP
human testis tissue were subjected to SDS PAGE followed by western blot with 12452-1-AP (VPS34 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
WB analysis of HeLa using 12452-1-AP
HeLa cells were subjected to SDS PAGE followed by western blot with 12452-1-AP (VPS34 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
WB analysis of human brain using 12452-1-AP
human brain tissue were subjected to SDS PAGE followed by western blot with 12452-1-AP (VPS34 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
WB analysis of mouse brain using 12452-1-AP
mouse brain tissue were subjected to SDS PAGE followed by western blot with 12452-1-AP (VPS34 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.
WB analysis of HeLa using 12452-1-AP
HeLa cells were subjected to SDS PAGE followed by western blot with 12452-1-AP (VPS34 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.
WB analysis of human brain using 12452-1-AP
human brain tissue were subjected to SDS PAGE followed by western blot with 12452-1-AP (VPS34 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.
WB analysis of HeLa using 12452-1-AP
HeLa cells were subjected to SDS PAGE followed by western blot with 12452-1-AP (VPS34 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.
WB analysis of mouse lung using 12452-1-AP
mouse lung tissue were subjected to SDS PAGE followed by western blot with 12452-1-AP (VPS34 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.
WB analysis of mouse testis using 12452-1-AP
mouse testis tissue were subjected to SDS PAGE followed by western blot with 12452-1-AP (VPS34 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.
IHC staining of human prostate cancer using 12452-1-AP
Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 12452-1-AP (VPS34 antibody at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human prostate cancer using 12452-1-AP
Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 12452-1-AP (VPS34 antibody at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human heart using 12452-1-AP
Immunohistochemical analysis of paraffin-embedded human heart using 12452-1-AP (VPS34 antibody) at dilution of 1:50 (under 10x lens).
IHC staining of human heart using 12452-1-AP
Immunohistochemical analysis of paraffin-embedded human heart using 12452-1-AP (VPS34 antibody) at dilution of 1:50 (under 40x lens).
IF Staining of PC-3 using 12452-1-AP
Immunofluorescent analysis of (-20°C Ethanol) fixed PC-3 cells using VPS34 (C terminal) antibody (12452-1-AP) at dilution of 1:600 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2).

Featured Product
KD/KO Validated

VPS34 (C terminal) Polyclonal antibody

Name: VPS34 (C terminal) Polyclonal antibody
Brand: Proteintech
SKU: 12452-1-AP

VPS34 (C terminal) Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 12452-1-AP

Publications(65)

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

Synonyms

PIK3C3, Vps34, EC:2.7.1.137, hVps34, PI 3 Kinase Class 3

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information
Publications (65)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	PC-3 cells, mouse brain tissue, HeLa cells, human testis tissue, human brain tissue, mouse lung tissue, mouse testis tissue, Jurkat cells, rat brain tissue
Positive IHC detected in	human prostate cancer tissue, human heart tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***
Positive IF/ICC detected in	PC-3 cells

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:500-1:1000
Immunohistochemistry (IHC)	IHC : 1:100-1:400
Immunofluorescence (IF)/ICC	IF/ICC : 1:300-1:1200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WB	See 62 publications below
IF	See 5 publications below
IP	See 2 publications below
CoIP	See 1 publications below

Product Information

12452-1-AP targets VPS34 (C terminal) in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Cited Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag3110 Product name: Recombinant human PIK3C3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 600-887 aa of BC033004 Sequence: KIRGIIPETATLFKSALMPAQLFFKTEDGGKYPVIFKHGDDLRQDQLILQIISLMDKLLRKENLDLKLTPYKVLATSTKHGFMQFIQSVPVAEVLDTEGSIQNFFRKYAPSENGPNGISAEVMDTYVKSCAGYCVITYILGVGDRHLDNLLLTKTGKLFHIDFGYILGRDPKPLPPPMKLNKEMVEGMGGTQSEQYQEFRKQCYTAFLHLRRYSNLILNLFSLMVDANIPDIALEPDKTVKKVQDKFRLDLSDEEAVHYMQSLIDESVHALFAAVVEQIHKFAQYWRK Predict reactive species
Full Name	phosphoinositide-3-kinase, class 3
Calculated Molecular Weight	887 aa, 100 kDa
Observed Molecular Weight	100 kDa
GenBank Accession Number	BC033004
Gene Symbol	VPS34
Gene ID (NCBI)	5289
RRID	AB_2299709
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q8NEB9
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PIK3C3(Phosphatidylinositol 3-kinase catalytic subunit type 3) is also named as VPS34 and belongs to the PI3/PI4-kinase family.It is a catalytic subunit of the PI3K complex that mediates formation of phosphatidylinositol 3-phosphate which plays a key role in initiation and maturation of autophagosomes.It can form a dimer(PMID:20339072).

Protocols

Product Specific Protocols
IF protocol for VPS34 (C terminal) antibody 12452-1-AP	Download protocol
IHC protocol for VPS34 (C terminal) antibody 12452-1-AP	Download protocol
WB protocol for VPS34 (C terminal) antibody 12452-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

Species	Application	Title
human	WB	Mol Cancer Overcoming multi-drug resistance in SCLC: a synergistic approach with venetoclax and hydroxychloroquine targeting the lncRNA LYPLAL1-DT/BCL2/BECN1 pathway Authors - Shuxin Li View Article
mouse	WB,IF	J Thromb Haemost Vps34 derived phosphatidylinositol 3-monophosphate modulates megakaryocyte maturation and proplatelet production through late endosomes/lysosomes. Authors - Ivana Bertović View Article
human	WB	Mol Cancer PMID: 32727463 Authors - Cefan Zhou View Article
human	WB	Nat Commun Endonuclease G promotes autophagy by suppressing mTOR signaling and activating the DNA damage response. Authors - Wenjun Wang View Article
human	WB	Nat Commun Structural basis for VPS34 kinase activation by Rab1 and Rab5 on membranes. Authors - Shirley Tremel View Article
	IP,CoIP	Nat Commun IL-6 regulates autophagy and chemotherapy resistance by promoting BECN1 phosphorylation. Authors - Fuqing Hu View Article