Tested Applications
| Positive WB detected in | Jurkat cells, HeLa cells, HL-60 cells, human liver tissue, K562, K-562 cells, L02 cells, THP-1 cells |
| Positive IP detected in | HL-60 cells |
| Positive IHC detected in | human malignant melanoma tissue, human stomach tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | SK-MEL-28 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
17817-1-AP targets RAB27A in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, rat, pig, canine, chicken |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag12136 Product name: Recombinant human RAB27A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-221 aa of BC107680 Sequence: MSDGDYDYLIKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVYRASGPDGATGRGQRIHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQRVVKEEEAIALAEKYGIPYFETSAANGTNISQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLSEEKEKGACGC Predict reactive species |
| Full Name | RAB27A, member RAS oncogene family |
| Calculated Molecular Weight | 221 aa, 25 kDa |
| Observed Molecular Weight | 25-27 kDa |
| GenBank Accession Number | BC107680 |
| Gene Symbol | RAB27A |
| Gene ID (NCBI) | 5873 |
| RRID | AB_2176728 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P51159 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Rab27A is a member of a large family of Ras-related small GTPases. The protein is membrane-bound and may be involved in protein transport and small GTPase mediated signal transduction. Recent studies suggest that Rab27A is associated with melanosomes in pigmented cells and regulates melanosome transport via its interaction with actin-based cellular motors such as myosin Va and myosin VIIa. RAB27A is also required for regulated secretion in cytotoxic T lymphocytes. Rab27A is implicated in several diseases, including Griscelli syndrome, choroideremia, and the Hermansky-Pudlak syndrome mouse model, gunmetal.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for RAB27A antibody 17817-1-AP | Download protocol |
| IHC protocol for RAB27A antibody 17817-1-AP | Download protocol |
| IP protocol for RAB27A antibody 17817-1-AP | Download protocol |
| WB protocol for RAB27A antibody 17817-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Anti-Rab27a antibody (Cat# 17817-1-AP) has accumulated 74 citations published across over 50 journals, including Nature Immunology, Nature Neuroscience, Nature Communications, Blood, Autophagy, Advanced Science, Science Advances, PNAS, Cell Reports, and Cell Death & Disease. Key research fields include exosome/extracellular vesicle biology, oncology (melanoma, renal, pancreatic, bladder cancer), neurodegeneration (ALS, Parkinson's disease), viral infections, immunology, diabetes, autophagy, cardiology, and hematology.
| Species | Application | Title |
|---|---|---|
Nat Immunol Exosomes mediate the cell-to-cell transmission of IFN-α-induced antiviral activity. | ||
Blood Extracellular vesicles released by CD40/IL-4 stimulated chronic lymphocytic leukemia cells confer altered functional properties to CD4+ T cells. | ||
Nat Neurosci Muscle-derived miR-126 regulates TDP-43 axonal local synthesis and NMJ integrity in ALS models. | ||
Autophagy Autophagy is dispensable for Kmt2a/Mll-Mllt3/Af9 AML maintenance and anti-leukemic effect of chloroquine. | ||
Autophagy Lipotoxic hepatocyte-derived UBQLN1-enriched small extracellular vesicles activate hepatic stellate cells to promote hepatic fibrosis. | ||
Nat Commun Exosomes maintain cellular homeostasis by excreting harmful DNA from cells.
|
