• Featured Product
  • KD/KO Validated

RAB3A Polyclonal antibody

RAB3A Polyclonal Antibody for WB, IP, IHC, ELISA
Cat No. 15029-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, CoIP, ELISA

RAB3A, Ras related protein Rab 3A

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse brain tissue, SH-SY5Y cells, human brain tissue, mouse cerebellum tissue, rat brain tissue
Positive IP detected inmouse brain tissue
Positive IHC detected inhuman gliomas tissue, mouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

15029-1-AP targets RAB3A in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1903

Product name: Recombinant human RAB3A protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-220 aa of BC011782

Sequence: MASATDSRYGQKESSDQNFDYMFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTIYRNDKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVLLVGNKCDMEDERVVSSERGRQLADHLGFEFFEASAKDNINVKQTFERLVDVICEKMSESLDTADPAVTGAKQGPQLSDQQVPPHQDCAC

Predict reactive species
Full Name RAB3A, member RAS oncogene family
Calculated Molecular Weight 25 kDa
Observed Molecular Weight 25 kDa
GenBank Accession NumberBC011782
Gene Symbol RAB3A
Gene ID (NCBI) 5864
RRIDAB_2177378
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP20336
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Rab3A is a small G-protein of the Rab family, that is implicated in vesicle fusion and regulated secretion, particularly in neurotransmitter release. Rab3 subfamily small G proteins (Rab3A, Rab3B, Rab3C, and Rab3D) control the regulated exocytosis in neuronal/secretory cells. Rab3A is the most abundant Rab GTPase in brain, where it is associated with synaptic vesicles. Rab3A is believed to modulate secretion efficiency by stimulating vesicle recruitment to sites of exocytosis and/ or by recruiting regulatory molecules to the docking/ fusion machinery.

Protocols

Product Specific Protocols
IHC protocol for RAB3A antibody 15029-1-APDownload protocol
IP protocol for RAB3A antibody 15029-1-APDownload protocol
WB protocol for RAB3A antibody 15029-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB,IHC,IF

Mol Oncol

Overexpression of synaptic vesicle protein Rab GTPase 3C promotes vesicular exocytosis and drug resistance in colorectal cancer cells

Authors - Yu-Chan Chang
humanIHC

Mol Cancer

Secretory RAB GTPase 3C modulates IL6-STAT3 pathway to promote colon cancer metastasis and is associated with poor prognosis.

Authors - Yu-Chan Chang
humanWB,IHC

Cell Death Dis

O-GlcNAcylation on Rab3A attenuates its effects on mitochondrial oxidative phosphorylation and metastasis in hepatocellular carcinoma.

Authors - Weicheng Wu
  • KD Validated
mouseWB

FASEB J

Role of RanBP9 on amyloidogenic processing of APP and synaptic protein levels in the mouse brain.

Authors - Lakshmana Madepalli K MK
mouseWB

PLoS One

RanBP9 Overexpression Accelerates Loss of Pre and Postsynaptic Proteins in the APΔE9 Transgenic Mouse Brain.

Authors - Hongjie Wang
humanWB

Biochem Pharmacol

Zoledronate modulates intracellular vesicle trafficking in mast cells via disturbing the interaction of myosinVa/Rab3a and sytaxin4/VAMP7.

Authors - Shuang Liu
Loading...
||
New chat Able
正在加载,请稍候...