Tested Applications
| Positive IP detected in | HEK-293 cells |
| Positive IHC detected in | mouse kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
12266-1-AP targets SCAP in WB, IF, IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2937 Product name: Recombinant human SCAP protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 601-905 aa of BC020987 Sequence: LQGNLIVVGRSSGRLEVWDAIEGVLCCSSEEVSSGITALVFLDKRIVAARLNGSLDFFSLETHTALSPLQFRGTPGRGSSPASPVYSSSDTVACHLTHTVPCAHQKPITALKAAAGRLVTGSQDHTLRVFRLEDSCCLFTLQGHSGAITTVYIDQTMVLASGGQDGAICLWDVLTGSRVSHVFAHRGDVTSLTCTTSCVISSGLDDLISIWDRSTGIKFYSIQQDLGCGASLGVISDNLLVTGGQGCVSFWDLNYGDLLQTVYLGKNSEAQPARQILVLDNAAIVCNFGSELSLVYVPSVLEKLD Predict reactive species |
| Full Name | SREBF chaperone |
| Calculated Molecular Weight | 1279 aa, 140 kDa |
| Observed Molecular Weight | 140 kDa |
| GenBank Accession Number | BC020987 |
| Gene Symbol | SCAP |
| Gene ID (NCBI) | 22937 |
| RRID | AB_10697683 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q12770 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SCAP is a regulatory protein that is required for the proteolytic cleavage of the sterol regulatory element-binding protein (SREBP). SCAP is an integral membrane protein located in the endoplasmic reticulum (ER). One of the cytosolic regions of SCAP contains a hexapeptide amino acid sequence, MELADL, that functions to detect cellular cholesterol. When cholesterol is present, SCAP undergoes a conformational change that prevents it from activating SREBP and cholesterol synthesis does not occur. SCAP has 4 isoforms with MW 140, 98, 96 and 85 kDa (refer to UniProt: Q12770).
Publications
What published studies show
Antibody 12266-1-AP (anti-SCAP) has 12 citations published in journals including Advanced Science, Cell Death & Disease, PNAS, Cell Reports, EMBO Reports, Scientific Reports, PLoS Pathogens, FASEB Journal, and Biochemical and Biophysical Research Communications. Research fields span cholesterol metabolism, ferroptosis in gastric cancer, prostate cancer drug resistance, diabetes-associated cognitive impairment, de novo lipid synthesis in cancer, antiviral immunity, mechanotransduction, and fatty liver disease.
| Species | Application | Title |
|---|---|---|
Adv Sci (Weinh) A Super-Enhancer-Driven Transcriptional Regulatory Circuit Underlying Abiraterone Resistance in Castration-Resistant Prostate Cancer | ||
Adv Sci (Weinh) HMGCR-Driven Cholesterol Metabolism Promotes Osteoarthritis Progression by Accelerating Synovial Fibroblast Senescence. | ||
Adv Sci (Weinh) Functional Suppression of SCAP Triggers Endoplasmic Reticulum Stress-Dependent Ferroptosis by Impairing Cholesterol Metabolism in Gastric Cancer. | ||
Cell Death Dis Astrocytic SCAP deletion ameliorates diabetes-associated cognitive impairment by suppressing microglial neuroinflammation and lipid droplet accumulation via the LCN2-24p3R-mTOR axis. | ||
Cell Rep Scap stabilizes PKM2 to promote glycolysis and enhance anti-fungal immunity in macrophages. |
Reviews
What customers say
All four reviewers report positive experiences with this SCAP antibody (lot 00014770). Two users confirmed strong performance in Western Blot at 1:1000 dilution, describing it as "very good quality." One user successfully used it for Immunoprecipitation at 1:600 with excellent results. Another achieved nice staining in IHC on human colon cancer tissue at 1:100. Overall, the antibody received an average rating of 4.8 out of 5, with consistent praise for its reliability across multiple applications including WB, IP, and IHC.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Sai Sindhura (Verified Customer) (03-23-2026) | SCAP antibody works very good
|
Sai Sindhura (Verified Customer) (01-08-2026) | IP worked very good with this antibody
|
Iram (Verified Customer) (09-18-2025) | Very good quality SCAP antibody
|
Iram (Verified Customer) (08-14-2020) | Nice staining we got in our tissue sections
|
