Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

SCD1 Polyclonal antibody

SCD1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (3)

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

SCD, Acyl CoA desaturase, Acyl-CoA desaturase, Delta(9) desaturase, Delta(9)-desaturase

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for SCD1 in ?

Tested Applications

Positive WB detected inA431 cells, A375 cells, A549 cells, HepG2 cells
Positive IHC detected inmouse liver tissue, human liver tissue, mouse brown adipose tissue, human colon cancer tissue, human ovary tumor tissue, human stomach cancer tissue, rat heart tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:16000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

28678-1-AP targets SCD1 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, monkey, chicken, goat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag29156

Product name: Recombinant human SCD protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-72 aa of BC005807

Sequence: MPAHLLQDDISSSYTTTTTITAPPSRVLQNGGDKLETMPLYLEDDIRPDIKDDIYDPTYKDKEGPSPKVEYV

Predict reactive species
Full Name stearoyl-CoA desaturase (delta-9-desaturase)
Calculated Molecular Weight 355 aa, 41 kDa
Observed Molecular Weight28-42 kDa
GenBank Accession NumberBC005807
Gene Symbol SCD
Gene ID (NCBI) 6319
RRIDAB_2923581
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO00767
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SCD1 (stearoyl-CoA desaturase) is a microsomal fatty acid monodesaturase, which catalyses the committed step in the biosynthesis of mono-unsaturated fatty acids from saturated fatty acids (PMID:10946019). SCD1 and SCD2 are the main isoforms expressed in mouse liver and brain respectively (PMID:15907797). The formation of homodimers and oligomers is an intrinsic property of SCD proteins. SCD1 is a multi-pass membrane protein and detected double bands of 37-42 kDa. The degradation product of 28 kDa may be caused by a major cleavage site at the C-terminus (PMID:15610069, PMID: 9843580).

Protocols

Product Specific Protocols
IF protocol for SCD1 antibody 28678-1-APDownload protocol
IHC protocol for SCD1 antibody 28678-1-APDownload protocol
WB protocol for SCD1 antibody 28678-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The SCD1 Polyclonal antibody (Cat# 28678-1-AP) has 112 citations published in journals including Nature, Cancer Cell, Nature Communications, Advanced Science, Science Advances, Clinical and Translational Medicine, Journal of Ethnopharmacology, Phytomedicine, and International Journal of Molecular Sciences. Research fields encompass lipid metabolism, de novo lipogenesis, ferroptosis, multiple cancer types (hepatocellular, colorectal, gastric, ovarian, melanoma), NAFLD/MASLD, diabetes, cardiovascular disease, obesity, gut microbiota, and natural product pharmacology.

SpeciesApplicationTitle

Cancer Cell

Multiomic integration reveals tumoral heterogeneity of lipid dependence within lethal group 3 medulloblastoma.

Authors - Flavia Bernardi
humanWB

Nature

7-Dehydrocholesterol dictates ferroptosis sensitivity

Authors - Yaxu Li
mouseIF

Nat Commun

Tracing immune cells around biomaterials with spatial anchors during large-scale wound regeneration

Authors - Yang Yang
humanWB,IHC

Nat Commun

Histone serotonylation promotes pancreatic cancer development via lipid metabolism remodeling.

Authors - Sang Lin
  • KD Validated
mouse,humanWB

Nat Commun

Targeting tRNA-dependent tyrosine usage unveils a metabolic vulnerability in hepatocellular carcinoma.

Authors - Hongli Zhang
mouseWB

Nat Commun

Lipid droplets sequester palmitic acid to disrupt endothelial ciliation and exacerbate atherosclerosis in male mice

Authors - Yanjie Tan

Reviews

    5.0 out of 5
Add a review

2 verified customer reviews

What customers say

Both reviewers gave this antibody a perfect 5-star rating for Western Blot applications. One user tested it on liver tissue at 1:5000 dilution, praising its high specificity and strong affinity toward the target protein, and also noted fast overnight shipping. The other user validated it on NRVCMs at 1:1000 dilution, confirming reliable performance. Overall, customers report consistent, specific results across different tissue types with no issues raised.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


YINGJIAN (Verified Customer) (08-07-2025)

The antibody demonstrates high specificity and strong affinity toward the target protein. Besides, the shipment very quick. It is overnight shipment.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:5000
  • Cell Tissue Type: liver
SCD1 Antibody Western Blot validation (1:5000 dilution) in liver (Cat no:28678-1-AP)

Marco (Verified Customer) (07-09-2024)

It does its job in NRVCMs

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: NRVCMs
Loading...
||
New chat

Able™

正在加载,请稍候...