Tested Applications
| Positive WB detected in | A431 cells, A375 cells, A549 cells, HepG2 cells |
| Positive IHC detected in | mouse liver tissue, human liver tissue, mouse brown adipose tissue, human colon cancer tissue, human ovary tumor tissue, human stomach cancer tissue, rat heart tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:16000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
28678-1-AP targets SCD1 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, monkey, chicken, goat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag29156 Product name: Recombinant human SCD protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-72 aa of BC005807 Sequence: MPAHLLQDDISSSYTTTTTITAPPSRVLQNGGDKLETMPLYLEDDIRPDIKDDIYDPTYKDKEGPSPKVEYV Predict reactive species |
| Full Name | stearoyl-CoA desaturase (delta-9-desaturase) |
| Calculated Molecular Weight | 355 aa, 41 kDa |
| Observed Molecular Weight | 28-42 kDa |
| GenBank Accession Number | BC005807 |
| Gene Symbol | SCD |
| Gene ID (NCBI) | 6319 |
| RRID | AB_2923581 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O00767 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SCD1 (stearoyl-CoA desaturase) is a microsomal fatty acid monodesaturase, which catalyses the committed step in the biosynthesis of mono-unsaturated fatty acids from saturated fatty acids (PMID:10946019). SCD1 and SCD2 are the main isoforms expressed in mouse liver and brain respectively (PMID:15907797). The formation of homodimers and oligomers is an intrinsic property of SCD proteins. SCD1 is a multi-pass membrane protein and detected double bands of 37-42 kDa. The degradation product of 28 kDa may be caused by a major cleavage site at the C-terminus (PMID:15610069, PMID: 9843580).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for SCD1 antibody 28678-1-AP | Download protocol |
| IHC protocol for SCD1 antibody 28678-1-AP | Download protocol |
| WB protocol for SCD1 antibody 28678-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The SCD1 Polyclonal antibody (Cat# 28678-1-AP) has 112 citations published in journals including Nature, Cancer Cell, Nature Communications, Advanced Science, Science Advances, Clinical and Translational Medicine, Journal of Ethnopharmacology, Phytomedicine, and International Journal of Molecular Sciences. Research fields encompass lipid metabolism, de novo lipogenesis, ferroptosis, multiple cancer types (hepatocellular, colorectal, gastric, ovarian, melanoma), NAFLD/MASLD, diabetes, cardiovascular disease, obesity, gut microbiota, and natural product pharmacology.
| Species | Application | Title |
|---|---|---|
Cancer Cell Multiomic integration reveals tumoral heterogeneity of lipid dependence within lethal group 3 medulloblastoma. | ||
Nat Commun Tracing immune cells around biomaterials with spatial anchors during large-scale wound regeneration | ||
Nat Commun Histone serotonylation promotes pancreatic cancer development via lipid metabolism remodeling.
| ||
Nat Commun Targeting tRNA-dependent tyrosine usage unveils a metabolic vulnerability in hepatocellular carcinoma. | ||
Nat Commun Lipid droplets sequester palmitic acid to disrupt endothelial ciliation and exacerbate atherosclerosis in male mice |
Reviews
What customers say
Both reviewers gave this antibody a perfect 5-star rating for Western Blot applications. One user tested it on liver tissue at 1:5000 dilution, praising its high specificity and strong affinity toward the target protein, and also noted fast overnight shipping. The other user validated it on NRVCMs at 1:1000 dilution, confirming reliable performance. Overall, customers report consistent, specific results across different tissue types with no issues raised.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
YINGJIAN (Verified Customer) (08-07-2025) | The antibody demonstrates high specificity and strong affinity toward the target protein. Besides， the shipment very quick. It is overnight shipment.
 |
Marco (Verified Customer) (07-09-2024) | It does its job in NRVCMs
|
