Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

GLUT3 Polyclonal antibody

GLUT3 Polyclonal Antibody for IHC, IF/ICC, ELISA

Cat No. 20403-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, IP, ELISA

GLUT 3, SLC2A3, GLUT-3

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IHC detected inmouse testis tissue, human lung cancer tissue, human breast cancer tissue, human placenta tissue, mouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inCaco-2 cells

Recommended dilution

ApplicationDilution
Immunohistochemistry (IHC)IHC : 1:2000-1:8000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

20403-1-AP targets GLUT3 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, goat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag14203

Product name: Recombinant human SLC2A3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 207-281 aa of BC039196

Sequence: ESPRFLLINRKEEENAKQILQRLWGTQDVSQDIQEMKDESARMSQEKQVTVLELFRVSSYRQPIIISIVLQLSQQ

Predict reactive species
Full Name solute carrier family 2 (facilitated glucose transporter), member 3
Calculated Molecular Weight 496 aa, 54 kDa
Observed Molecular Weight54-60 kDa
GenBank Accession NumberBC039196
Gene Symbol GLUT3
Gene ID (NCBI) 6515
RRIDAB_10694437
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP11169
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Glucose transporter 3 (GLUT3), also known as solute carrier family 2, facilitated glucose transporter member 3 (SLC2A3), is a transporter protein regulating glucose transport across cell membranes and is a primary glucose transporter in neurons.

What is the molecular weight of GLUT3? Is GLUT3 post-translationally modified?

The molecular weight of GLUT3 transporter is 49-52 kDa and depends on the glycosylation pattern, which is tissue-specific (PMID: 9253355 and 9889355). GLUT3 can be N-glycosylated.

What is the subcellular localization of GLUT3?

Glucose transporters, including GLUT3, are multiple-pass integral membrane proteins. GLUT3 is present at the plasma membrane but is also a subject of recycling between the plasma membrane and endosomes. 

What molecules can be transported by GLUT3?

Although the main substrate of GLUT3 transport is glucose, it can also transport mannose, galactose, and xylose.

What is the tissue expression pattern of GLUT3?

GLUT1 and GLUT3 are important for the transport of glucose into the central nervous system. While GLUT1 transports glucose through blood vessels and into astrocytes, GLUT3 is predominantly expressed in neurons, being their main glucose transporter (PMID: 9302083), and in testis (PMID: 18577699).


Protocols

Product Specific Protocols
IF protocol for GLUT3 antibody 20403-1-APDownload protocol
IHC protocol for GLUT3 antibody 20403-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
humanWB

Mol Cancer

CircEZH2/miR-133b/IGF2BP2 aggravates colorectal cancer progression via enhancing the stability of m6A-modified CREB1 mRNA.

Authors - Bing Yao
mouseWB

Cell Metab

Acetate enables metabolic fitness and cognitive performance during sleep disruption

Authors - Qinqin He
humanWB,IHC

Nat Metab

Acetate reprogrammes tumour metabolism and promotes PD-L1 expression and immune evasion by upregulating c-Myc

Authors - Juhong Wang
mouseWB,IF

Nat Aging

Activation of AMPK by GLP-1R agonists mitigates Alzheimer-related phenotypes in transgenic mice

Authors - Yun Zhang
mouseWB

Bone Res

SphK1/mitophagy axis in cementocytes drives orthodontic root resorption via mitochondrial transfer to osteoclasts.

Authors - Han Wang
humanWB

Autophagy

Newcastle disease virus degrades SIRT3 via PINK1-PRKN-dependent mitophagy to reprogram energy metabolism in infected cells.

Authors - Yabin Gong

Reviews

    4.5 out of 5
Add a review

4 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Alfonso (Verified Customer) (09-03-2026)

This polyclonal GLUT3 antibody from Proteintech (20403-1-AP) performed excellently in FFPE human vascular tissues at a 1:1000 dilution following high-pH HIER (Tris-EDTA buffer). The immunostaining was clean and crisp with no appreciable background.   The attached micrograph shows strong GLUT3 immunoreactivity in red blood cells within blood vessels.

  • Applications: Immunohistochemistry
  • Primary Antibody Dilution: 1:2000
  • Cell Tissue Type: Erythrocytes within human blood vessels.
GLUT3 Antibody Immunohistochemistry validation (1:2000 dilution) in Erythrocytes within human blood vessels. (Cat no:20403-1-AP)

Sai Sindhura (Verified Customer) (01-08-2026)

GLUT3 is working very well for my pancreatitis project

  • Applications: Western Blot, Immunofluorescence, ChIP
  • Primary Antibody Dilution: 1:800

balawant (Verified Customer) (12-25-2023)

This antibody is very specific and has no background.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1200
  • Cell Tissue Type: Renal Cancer cell line caki-1 and caki-2

Hua (Verified Customer) (02-03-2023)

This antibody works ok. There is one strong non-specific band around 40 kDa.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: HepG2, mouse liver, and mouse brain tissues
GLUT3 Antibody Western Blot validation (1:1000 dilution) in HepG2, mouse liver, and mouse brain tissues (Cat no:20403-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...