Tested Applications
| Positive WB detected in | pig kidney tissue, mouse brain tissue, rat brain tissue, rabbit brain tissue |
| Positive IHC detected in | human liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
| Positive FC (Intra) detected in | U2OS cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
68594-1-Ig targets SMAD7 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.
| Tested Reactivity | human, mouse, rat, pig, rabbit |
| Cited Reactivity | mouse, rat, rabbit |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag13688 Product name: Recombinant human SMAD7 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-426 aa of BC074819 Sequence: MFRTKRSALVRRLWRSRAPGGEDEEEGAGGGGGGGELRGEGATDSRAHGAGGGGPGRAGCCLGKAVRGAKGHHHPHPPAAGAGAAGGAEADLKALTHSVLKKLKERQLELLLQAVESRGGTRTACLLLPGRLDCRLGPGAPAGAQPAQPPSSYSLPLLLCKVFRWPDLRHSSEVKRLCCCESYGKINPELVCCNPHHLSRLCELESPPPPYSRYPMDFLKPTADCPDAVPSSAETGGTNYLAPGGLSDSQLLLEPGDRSHWCVVAYWEEKTRVGRLYCVQEPSLDIFYDLPQGNGFCLGQLNSDNKSQLVQKVRSKIGCGIQLTREVDGVWVYNRSSYPIFIKSATLDNPDSRTLLVHKVFPGFSIKAFDYEKAYSLQRPNDHEFMQQPWTGFTVQISFVKGWGQCYTRQFISSCPCWLEVIFNSR Predict reactive species |
| Full Name | SMAD family member 7 |
| Calculated Molecular Weight | 426 aa, 46 kDa |
| Observed Molecular Weight | 45-55 kDa |
| GenBank Accession Number | BC074819 |
| Gene Symbol | SMAD7 |
| Gene ID (NCBI) | 4092 |
| RRID | AB_3085293 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | O15105 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SMAD7, also named as Mothers against decapentaplegic homolog 7, is a 426 amino acid protein, which belongs to the dwarfin/SMAD family. SMAD7 Interaction with NEDD4L or RNF111 induces translocation from the nucleus to the cytoplasm (PubMed:16601693). TGF-beta stimulates its translocation from the nucleus to the cytoplasm. PDPK1 inhibits its translocation from the nucleus to the cytoplasm in response to TGF-beta (PubMed:17327236). SMAD7 as antagonist of signaling by TGF-beta type 1 receptor superfamily members has been shown to inhibit TGF-beta and activin signaling by associating with their receptors thus preventing SMAD2 access. SMAD7 functions as an adapter to recruit SMURF2 to the TGF-beta receptor complex and also acts by recruiting the PPP1R15A-PP1 complex to TGFBR1, which promotes its dephosphorylation. SMAD7 positively regulates PDPK1 kinase activity by stimulating its dissociation from the 14-3-3 protein YWHAQ which acts as a negative regulator.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for SMAD7 antibody 68594-1-Ig | Download protocol |
| IF protocol for SMAD7 antibody 68594-1-Ig | Download protocol |
| IHC protocol for SMAD7 antibody 68594-1-Ig | Download protocol |
| WB protocol for SMAD7 antibody 68594-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The SMAD7 Monoclonal antibody (3D1C3), catalog number 68594-1-Ig, has 4 total citations. These appear in Advances in Healthcare Materials, Journal of Headache and Pain, European Journal of Pharmacology, and Photodiagnosis and Photodynamic Therapy. The associated research fields include cartilage regeneration and tissue engineering, central post-stroke pain modulation, cardiac fibrosis, and myocardial remodeling, all involving the TGF-β/Smad signaling pathway.
| Species | Application | Title |
|---|---|---|
Adv Healthc Mater Enhanced Auricular Cartilage Regeneration via 3D-Printed Hydrogel With miR-92a-3p-Enriched Platelet-Rich Plasma-Derived Extracellular Vesicles. | ||
J Headache Pain Electroacupuncture alleviates central post-stroke pain in rats by modulating miR-21-5p/TGF-β/Smads pathway. | ||
Eur J Pharmacol Hyperbaric oxygen therapy alleviates acute carbon monoxide poisoning-induced transition of cardiac fibroblast to myofibroblast and ameliorates cardiac fibrosis via the NRF2/ROS/TGFβ1/Smad pathway. | ||
Photodiagnosis Photodyn Ther Photobiomodulation therapy inhibits ISO-induced myocardial remodeling in mice through modulating TGF-β/Smad7 and PI3K/AKT pathways. |
