Tested Applications
| Positive WB detected in | mouse liver tissue, rat liver tissue |
| Positive IHC detected in | human liver cancer tissue, human liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | A431 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:100-1:400 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
15880-1-AP targets TDO2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, chicken |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag8642 Product name: Recombinant human TDO2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 55-406 aa of BC005355 Sequence: QELQSETKGNKIHDEHLFIITHQAYELWFKQILWELDSVREIFQNGHVRDERNMLKVVSRMHRVSVILKLLVQQFSILETMTALDFNDFREYLSPASGFQSLQFRLLENKIGVLQNMRVPYNRRHYRDNFKGEENELLLKSEQEKTLLELVEAWLERTPGLEPHGFNFWGKLEKNITRGLEEEFIRIQAKEESEEKEEQVAEFQKQKEVLLSLFDEKRHEHLLSKGERRLSYRALQGALMIYFYREEPRFQVPFQLLTSLMDIDSLMTKWRYNHVCMVHRMLGSKAGTGGSSGYHYLRSTVSDRYKVFVDLFNLSTYLIPRHWIPKMNPTIHKFLYTAEYCDSSYFSSDESD Predict reactive species |
| Full Name | tryptophan 2,3-dioxygenase |
| Calculated Molecular Weight | 406 aa, 48 kDa |
| Observed Molecular Weight | 40-50 kDa |
| GenBank Accession Number | BC005355 |
| Gene Symbol | TDO2 |
| Gene ID (NCBI) | 6999 |
| RRID | AB_2827610 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P48775 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TDO2 (tryptophan 2,3-dioxygenase), IDO1 (indoleamine 2,3-dioxygenase 1) and IDO2 are three enzymes that catalyze the amino acid tryptophan into kynurenine in the kynurenine pathway (PMID: 23090118, 28469468). TDO2 plays an important role in neurological diseases such as Alzheimer's disease, Parkinson's disease and autism. Overexpression of TDO2 promoted tumor cell survival and was correlated with tumor grade and poor prognosis in triple negative breast cancer, brain tumors and esophageal squamous cell carcinoma. TDO2 may be a potential therapeutic target in some cancers. (PMID: 21976023, 30134247)
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for TDO2 antibody 15880-1-AP | Download protocol |
| IHC protocol for TDO2 antibody 15880-1-AP | Download protocol |
| WB protocol for TDO2 antibody 15880-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The TDO2 Polyclonal Antibody (CAT# 15880-1-AP) has 68 total citations. Publications appear in journals including Nature Communications, Cancer Cell, Cell Metabolism, Signal Transduction and Targeted Therapy, Cell Reports, British Journal of Pharmacology, Frontiers in Immunology, Molecular Metabolism, iScience, and BMC series journals. Research fields span tryptophan/kynurenine metabolism, oncology (liver, breast, prostate, gastric, ovarian, lung cancers), immunology, neurology/psychiatry, inflammatory and autoimmune diseases, liver disease, kidney injury, atherosclerosis, and gut microbiota.
| Species | Application | Title |
|---|---|---|
Signal Transduct Target Ther The proatherosclerotic function of indoleamine 2, 3-dioxygenase 1 in the developmental stage of atherosclerosis. | ||
Cancer Cell Spatial transcriptomics reveals tryptophan metabolism restricting maturation of intratumoral tertiary lymphoid structures | ||
Cancer Cell Inhibition of De Novo NAD(+) Synthesis by Oncogenic URI Causes Liver Tumorigenesis through DNA Damage.
| ||
Cell Metab AARS1 promotes tumor progression and immune evasion via ATF6 lactylation-mediated tryptophan metabolism in hepatocellular carcinoma | ||
Cancer Commun (Lond) Tryptophan 2,3-dioxygenase-positive matrix fibroblasts fuel breast cancer lung metastasis via kynurenine-mediated ferroptosis resistance of metastatic cells and T cell dysfunction | ||
Protein Cell AhR-Siglec-15 axis regulates lysosomal Ca2+ release for sonic hedgehog medulloblastoma growth via TRPML1 |
Reviews
What customers say
Both reviews are from the same user who rated the antibody 5/5 stars for Western Blot. The user tested it on hepatoblastoma cells and liver cells transduced with lentivirus expressing TDO2, using dilutions of 1/750–1/2000 (lot 00049827). Comments were brief but strongly positive, describing the antibody as "very good" and "so efficient." Overall, reviewers report reliable performance in WB with transduced cell lines at moderate dilutions.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Hala (Verified Customer) (03-10-2021) | works veryyy gooddd
|
Hala (Verified Customer) (12-15-2020) | so efficient
 |
