Tested Applications
| Positive WB detected in | HeLa cells, HepG2 cells |
| Positive IHC detected in | human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells, HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
11973-1-AP targets TIMM13 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2596 Product name: Recombinant human TIMM13 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-95 aa of BC008607 Sequence: MEGGFGSDFGGSGSGKLDPGLIMEQVKVQIAVANAQELLQRMTDKCFRKCIGKPGGSLDNSEQKCIAMCMDRYMDAWNTVSRAYNSRLQRERANM Predict reactive species |
| Full Name | translocase of inner mitochondrial membrane 13 homolog (yeast) |
| Calculated Molecular Weight | 95 aa, 11 kDa |
| Observed Molecular Weight | 11 kDa |
| GenBank Accession Number | BC008607 |
| Gene Symbol | TIMM13 |
| Gene ID (NCBI) | 26517 |
| RRID | AB_2287228 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9Y5L4 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TIMM13 gene, also known as TIM13, TIM13B, TIM M13A or TIMM13B, encodes mitochondrial import inner membrane translocase subunit Tim13 belonging to the small Tim family. TIM13 functions as mitochondrial intermembrane chaperone that participates in the import and insertion of some multi-pass transmembrane proteins into the mitochondrial inner membrane. Proteins of the intermembrane space (IMS) of mitochondria are typically synthesized without presequences. TIM13 contains four conserved cysteine residues that bind a zinc ion as cofactor. Import of TIM13 did not depend on the membrane potential or ATP hydrolysis. Upon import into mitochondria TIM13 adopted a stably folded conformation in the IMS.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for TIMM13 antibody 11973-1-AP | Download protocol |
| IHC protocol for TIMM13 antibody 11973-1-AP | Download protocol |
| WB protocol for TIMM13 antibody 11973-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
TIMM13 Polyclonal antibody (Cat# 11973-1-AP) has 11 citations published in journals including Cell Stem Cell, Science Advances, Cell Death & Differentiation, American Journal of Human Genetics, EMBO Reports, Oncology Research, Frontiers in Oncology, FEBS Letters, Molecular Genetics & Metabolism Reports, Molecular Genetics & Genomic Medicine, and eLife. Research fields span mitochondrial biology, cancer (leukemia, lung and colorectal cancer), human genetic diseases, and mitochondrial protein transport.
| Species | Application | Title |
|---|---|---|
Cell Stem Cell Disrupting Mitochondrial Copper Distribution Inhibits Leukemic Stem Cell Self-Renewal. | ||
Sci Adv Hypoxia-responsive interaction between P-TEFb, BHLHE40, and Tim8-Tim13 regulates hypoxic gene transcription. | ||
Cell Death Differ Targeting prohibitins activates the ISR through DELE1-HRI by impairing protein import into the mitochondrial matrix. | ||
Am J Hum Genet The mitochondrial disulfide relay system protein GFER is mutated in autosomal-recessive myopathy with cataract and combined respiratory-chain deficiency. | ||
EMBO Rep Human Tim8a, Tim8b and Tim13 are auxiliary assembly factors of mature Complex IV | ||
Reviews
What customers say
One reviewer (5/5 stars) used this antibody for immunofluorescence to label mitochondria in HeLa FlipIn cells at a 1:100 dilution. The protocol involved 4% paraformaldehyde fixation (10 min, RT), 0.1% Triton X-100 permeabilization, overnight primary antibody incubation at 4°C, and 1 hour secondary antibody (Alexa Fluor 488, 1:700) at RT. The user reported successful results with this protocol.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Süleyman (Verified Customer) (01-22-2022) | I tested for IMS labelling of mitochondria. I used 1:700 Alexa Fluor 488 secondary antibody. Fixed 4% paraformaldehyde in PBS for 10 minutes at RT and 0.1% Triton X permeabilization. Overnight primary ab labelling at 4 oC. 1 hour secondary ab labelling at RT.
 |
