TMPRSS2 Polyclonal antibody

TMPRSS2 Polyclonal Antibody for WB, IHC, IF-P, ELISA
Cat No. 14437-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF-P, ELISA

Transmembrane protease serine 2 non-catalytic chain, Transmembrane protease serine 2 catalytic chain, PRSS10, PP9284, EC:3.4.21.122

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inCOLO 320 cells, Caco-2 cells, T-47D cells
Positive IHC detected inhuman colon cancer tissue, human prostate cancer tissue, mouse kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman tonsillitis tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:100-1:400
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

14437-1-AP targets TMPRSS2 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, monkey
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag5824

Product name: Recombinant human TMPRSS2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 108-492 aa of BC051839

Sequence: FMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRADG

Predict reactive species
Full Name transmembrane protease, serine 2
Calculated Molecular Weight 54 kDa
Observed Molecular Weight 70, 54, 31 kDa
GenBank Accession NumberBC051839
Gene Symbol TMPRSS2
Gene ID (NCBI) 7113
RRIDAB_2878058
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO15393
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TMPRSS2, also named as PRSS10, is a type II transmembrane serine protease which is highly expressed by the epithelium of the human prostate gland. TMPRSS2 may contribute to prostate tumour metastasis via the activation of PAR-2. TMPRSS2 is a Serine protease that proteolytically cleaves and activates the viral spike glycoproteins which facilitate virus-cell membrane fusions. TMPRSS2 is a host cell factor that is critical for the spread of several clinically relevant viruses, including influenza A viruses and coronaviruses (PMID: 23468491, 30626688). SARS-CoV-2 uses the SARS-CoV receptor ACE2 for entry and the serine protease TMPRSS2 for S protein priming. The initial spike protein priming by TMPRSS2 is essential for the entry and viral spread of SARS-CoV-2 through interaction with the ACE2 receptor (PMID: 32142651, 30626688 ). Camostat mesylate, an inhibitor of TMPRSS2, can block SARS-CoV-2 infection of lung cells (PMID: 32142651). The MW of TMPRSS2 is about 65-70 kDa. It can be cleaved into some chains with MW 54 kDa, 31 kDa and 26 kDa (PMID: 25734995, 20382709, 26018085).

Protocols

Product Specific Protocols
WB protocol for TMPRSS2 antibody 14437-1-APDownload protocol
IHC protocol for TMPRSS2 antibody 14437-1-APDownload protocol
IF protocol for TMPRSS2 antibody 14437-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Nat Microbiol

SARS-CoV-2 Omicron is an immune escape variant with an altered cell entry pathway.

Authors - Brian J Willett
humanWB

Allergy

Distinct expression of SARS-CoV-2 receptor ACE2 correlates with endotypes of chronic rhinosinusitis with nasal polyps.

Authors - Ming Wang
humanWB

Eur Respir J

Influenza virus infection increases ACE2 expression and shedding in human small airway epithelial cells.

Authors - Kelly S Schweitzer
humanWB

Theranostics

Environmentally-induced mdig contributes to the severity of COVID-19 through fostering expression of SARS-CoV-2 receptor NRPs and glycan metabolism.

Authors - Qian Zhang
humanWB

Mol Ther Nucleic Acids

The accessible promoter-mediated supplementary effect of host factors provides new insight into the tropism of SARS-CoV-2.

Authors - Guifang Du
humanIF

PLoS Pathog

Infection of human Nasal Epithelial Cells with SARS-CoV-2 and a 382-nt deletion isolate lacking ORF8 reveals similar viral kinetics and host transcriptional profiles.

Authors - Akshamal M Gamage

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Christine (Verified Customer) (12-14-2021)

I transfected HEK293T cells with a plasmid encoding the long isoform of TMPRSS2 with a FLAG tag at the C terminus. I analysed the expression of TMPRSS2 (not expressed endogenously by HEK293T) with the TMPRSS2 antibody but did not detect any difference between transfected and untransfected cells, whereas I could clearly detect it with an anti FLAG antibody. So this antibody might work better on endogenous TMPRSS2 and not very well against my tagged version?

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:2000
  • Cell Tissue Type: transfected HEK293T
Loading...
||
New chat Able
正在加载,请稍候...