Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

p63 Polyclonal antibody

p63 Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, FC (Intra), IP, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IF-P, FC (Intra), IP, CoIP, ChIP, ELISA

TP63, CUSP, TP 63, Transformation-related protein 63, Tumor protein 63

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for p63 in ?

Tested Applications

Positive WB detected inA431 cells, human heart tissue, mouse heart tissue, U-937 cells, Apoptosised HeLa cells, HaCaT cells, PC-12 cells, mouse thymus tissue
Positive IP detected inA431 cells
Positive IHC detected inhuman tonsillitis tissue, human bowen disease tissue, human lung cancer tissue, human prostate cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman lung cancer tissue
Positive IF/ICC detected inA431 cells
Positive FC (Intra) detected inA431 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:3000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:2000-1:8000
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:500-1:2000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

12143-1-AP targets p63 in WB, IHC, IF/ICC, IF-P, FC (Intra), IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag2791

Product name: Recombinant human TP63 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 381-680 aa of BC039815

Sequence: NTHGIQMTSIKKRRSPDDELLYLPVRGRETYEMLLKIKESLELMQYLPQHTIETYRQQQQQQHQHLLQKQTSIQSPSSYGNSSPPLNKMNSMNKLPSVSQLINPQQRNALTPTTIPDGMGANIPMMGTHMPMAGDMNGLSPTQALPPPLSMPSTSHCTPPPPYPTDCSIVSFLARLGCSSCLDYFTTQGLTTIYQIEHYSMDDLASLKIPEQFRHAIWKGILDHRQLHEFSSPSHLLRTPSSASTVSVGSSETRGERVIDAVRFTLRQTISFPPRDEWNDFNFDMDARRNKQQRIKEEGE

Predict reactive species
Full Name tumor protein p63
Calculated Molecular Weight 680 aa, 77 kDa
Observed Molecular Weight 63-68 kDa
GenBank Accession NumberBC039815
Gene Symbol TP63
Gene ID (NCBI) 8626
RRIDAB_10597397
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9H3D4
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TP63, also named KET, P63, P73H, P73L and TP73L, belongs to the p53 family. It is a homologue of the tumor suppressor p53 and p73 genes. It is involved in malignancy acquisition and maintenance of cells. Unlike p53, the p63 gene encodes multiple isotypes with remarkably divergent abilities to transactivate p53 reporter genes and induce apoptosis. TP63 acts as a sequence specific DNA binding transcriptional activator or repressor. TP63 has 12 isoforms with MW 40kd(P40), 50kd(P60),63kd(P63) and 73kd(P73L).

Protocols

Product Specific Protocols
FC protocol for p63 antibody 12143-1-APDownload protocol
IF protocol for p63 antibody 12143-1-APDownload protocol
IHC protocol for p63 antibody 12143-1-APDownload protocol
IP protocol for p63 antibody 12143-1-APDownload protocol
WB protocol for p63 antibody 12143-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The p63 polyclonal antibody (Cat# 12143-1-AP) has accumulated 64 citations in high-impact journals including Nature, Nature Genetics, Cancer Research, Cell Reports, Oncogene, Journal of Experimental Medicine, and Investigative Ophthalmology & Visual Science. Associated research fields encompass cancer biology (esophageal, lung, prostate, colorectal, and bladder carcinomas), stem cell biology (limbal and corneal epithelial stem cells), skin biology and wound healing, tumor organoid culture, ferroptosis and cuproptosis, neuroinflammation, and epithelial differentiation.

SpeciesApplicationTitle
mouseIHC

Nature

Divergent transcriptional regulation of astrocyte reactivity across disorders.

Authors - Joshua E Burda
humanWB,IP

Nat Genet

Epigenetic therapy potentiates transposable element transcription to create tumor-enriched antigens in glioblastoma cells

Authors - H Josh Jang
mouseIHC

Nat Genet

A combinatorial genetic strategy for exploring complex genotype-phenotype associations in cancer

Authors - Shan Li
humanIF

Bioact Mater

Probiotic-inspired hybrid nanovesicles for enhancing immune checkpoint therapy efficiency via tumor immune microenvironment modulation.

Authors - Fang Wang
humanIF

Bioact Mater

Biomimetic hydrogels with mesoscale collagen architecture for patient-derived tumor organoids culture

Authors - Jiaxin Wang
humanIHC

Cancer Res

TRAPPC4 Promotes GPX4 Stability to Drive Ferroptosis Resistance and Tumor Progression in Head and Neck Squamous Cell Carcinoma

Authors - Zhao Ding

Reviews

    4.5 out of 5
Add a review

2 verified customer reviews

What customers say

Both reviewers used lot 00041383 and reported positive results. One user achieved good Western Blot performance on mouse brain tissue at a 1:500 dilution (4/5 rating). The other used the antibody for immunofluorescence on mouse esophagus at 1:200 dilution, calling it the best P63 antibody they had found so far (5/5 rating). Overall, customers are satisfied with specificity and performance across applications.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Tanusree (Verified Customer) (12-18-2019)

Product worked well in WB at 1:500 dilution

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: Mouse brain

Kui (Verified Customer) (09-19-2019)

Best P63 Ab I can find so far.

  • Applications: Immunofluorescence,
  • Primary Antibody Dilution: 1:200
  • Cell Tissue Type: Mouse Esophagus
p63 Antibody Immunofluorescence, validation (1:200 dilution) in Mouse Esophagus (Cat no:12143-1-AP)
Loading...
||
New chat

Able™

正在加载,请稍候...