Tested Applications
| Positive WB detected in | A431 cells, human heart tissue, mouse heart tissue, U-937 cells, Apoptosised HeLa cells, HaCaT cells, PC-12 cells, mouse thymus tissue |
| Positive IP detected in | A431 cells |
| Positive IHC detected in | human tonsillitis tissue, human bowen disease tissue, human lung cancer tissue, human prostate cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human lung cancer tissue |
| Positive IF/ICC detected in | A431 cells |
| Positive FC (Intra) detected in | A431 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:2000-1:8000 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:500-1:2000 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
12143-1-AP targets p63 in WB, IHC, IF/ICC, IF-P, FC (Intra), IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2791 Product name: Recombinant human TP63 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 381-680 aa of BC039815 Sequence: NTHGIQMTSIKKRRSPDDELLYLPVRGRETYEMLLKIKESLELMQYLPQHTIETYRQQQQQQHQHLLQKQTSIQSPSSYGNSSPPLNKMNSMNKLPSVSQLINPQQRNALTPTTIPDGMGANIPMMGTHMPMAGDMNGLSPTQALPPPLSMPSTSHCTPPPPYPTDCSIVSFLARLGCSSCLDYFTTQGLTTIYQIEHYSMDDLASLKIPEQFRHAIWKGILDHRQLHEFSSPSHLLRTPSSASTVSVGSSETRGERVIDAVRFTLRQTISFPPRDEWNDFNFDMDARRNKQQRIKEEGE Predict reactive species |
| Full Name | tumor protein p63 |
| Calculated Molecular Weight | 680 aa, 77 kDa |
| Observed Molecular Weight | 63-68 kDa |
| GenBank Accession Number | BC039815 |
| Gene Symbol | TP63 |
| Gene ID (NCBI) | 8626 |
| RRID | AB_10597397 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9H3D4 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TP63, also named KET, P63, P73H, P73L and TP73L, belongs to the p53 family. It is a homologue of the tumor suppressor p53 and p73 genes. It is involved in malignancy acquisition and maintenance of cells. Unlike p53, the p63 gene encodes multiple isotypes with remarkably divergent abilities to transactivate p53 reporter genes and induce apoptosis. TP63 acts as a sequence specific DNA binding transcriptional activator or repressor. TP63 has 12 isoforms with MW 40kd(P40), 50kd(P60),63kd(P63) and 73kd(P73L).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for p63 antibody 12143-1-AP | Download protocol |
| IF protocol for p63 antibody 12143-1-AP | Download protocol |
| IHC protocol for p63 antibody 12143-1-AP | Download protocol |
| IP protocol for p63 antibody 12143-1-AP | Download protocol |
| WB protocol for p63 antibody 12143-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The p63 polyclonal antibody (Cat# 12143-1-AP) has accumulated 64 citations in high-impact journals including Nature, Nature Genetics, Cancer Research, Cell Reports, Oncogene, Journal of Experimental Medicine, and Investigative Ophthalmology & Visual Science. Associated research fields encompass cancer biology (esophageal, lung, prostate, colorectal, and bladder carcinomas), stem cell biology (limbal and corneal epithelial stem cells), skin biology and wound healing, tumor organoid culture, ferroptosis and cuproptosis, neuroinflammation, and epithelial differentiation.
| Species | Application | Title |
|---|---|---|
Nat Genet Epigenetic therapy potentiates transposable element transcription to create tumor-enriched antigens in glioblastoma cells | ||
Nat Genet A combinatorial genetic strategy for exploring complex genotype-phenotype associations in cancer | ||
Bioact Mater Probiotic-inspired hybrid nanovesicles for enhancing immune checkpoint therapy efficiency via tumor immune microenvironment modulation. | ||
Bioact Mater Biomimetic hydrogels with mesoscale collagen architecture for patient-derived tumor organoids culture | ||
Cancer Res TRAPPC4 Promotes GPX4 Stability to Drive Ferroptosis Resistance and Tumor Progression in Head and Neck Squamous Cell Carcinoma |
Reviews
What customers say
Both reviewers used lot 00041383 and reported positive results. One user achieved good Western Blot performance on mouse brain tissue at a 1:500 dilution (4/5 rating). The other used the antibody for immunofluorescence on mouse esophagus at 1:200 dilution, calling it the best P63 antibody they had found so far (5/5 rating). Overall, customers are satisfied with specificity and performance across applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Tanusree (Verified Customer) (12-18-2019) | Product worked well in WB at 1:500 dilution
|
Kui (Verified Customer) (09-19-2019) | Best P63 Ab I can find so far.
 |
