Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

UGCG Polyclonal antibody

UGCG Polyclonal Antibody for WB, IHC, IF-P, IF-Fro, IP, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, IF-Fro, IP, ELISA

Ceramide glucosyltransferase, EC:2.4.1.80, GCS, GLCT-1, Glucosylceramide synthase

Formulation:  PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for UGCG in ?

Tested Applications

Positive WB detected inA375 cells, C6 cells, mouse brain tissue, U-251 cells
Positive IP detected inA375 cells
Positive IHC detected inhuman lung cancer tissue, human breast cancer tissue, human lymphoma tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse kidney tissue, mouse brain tissue
Positive IF-Fro detected inmouse kidney tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Immunofluorescence (IF)-FROIF-FRO : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

12869-1-AP targets UGCG in WB, IHC, IF-P, IF-Fro, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag3530

Product name: Recombinant human UGCG protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 31-312 aa of BC038711

Sequence: IYTRLHLNKKATDKQPYSKLPGVSLLKPLKGVDPNLINNLETFFELDYPKYEVLLCVQDHDDPAIDVCKKLLGKYPNVDARLFIGGKKVGINPKINNLMPGYEVAKYDLIWICDSGIRVIPDTLTDMVNQMTEKVGLVHGLPYVADRQGFAATLEQVYFGTSHPRYYISANVTGFKCVTGMSCLMRKDVLDQAGGLIAFAQYIAEDYFMAKAIADRGWRFAMSTQVAMQNSGSYSISQFQSRMIRWTKLRINMLPATIICEPISECFVASLIIGWAAHHVFR

Predict reactive species
Full Name UDP-glucose ceramide glucosyltransferase
Calculated Molecular Weight 394 aa, 45 kDa
Observed Molecular Weight 50-55 kDa
GenBank Accession NumberBC038711
Gene Symbol UGCG
Gene ID (NCBI) 7357
RRIDAB_10915469
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ16739
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

UGCG, also named as GCS and GLCT-1, belongs to the glycosyltransferase 2 family. It catalyzes the first glycosylation step in glycosphingolipid biosynthesis, the transfer of glucose to ceramide. UGCG may also serve as a "flippase". It is up-regulated at the transcriptional level during keratinocyte differentiation. UGCG is a membrane protein. The calculated MW is 45 kDa. In SDS-PAGE, it is about 50-55 kDa.

Publications

What published studies show

The anti-UGCG antibody (Cat# 12869-1-AP) has 15 total citations published in journals including Nature Communications, Cancer Research, Acta Pharmacologica Sinica, PLoS Biology, Human Molecular Genetics, iScience, Scientific Reports, Frontiers in Pharmacology, International Journal of Biological Macromolecules, Cellular and Molecular Biology Letters, Aging, and International Journal of Molecular Sciences. Research fields span sphingolipid metabolism, cancer (breast, colon, NSCLC), liver fibrosis, neurodegeneration (ALS, Parkinson's), drug resistance, and viral infection.

SpeciesApplicationTitle
mouse,humanWB

Cancer Res

Aneuploid cell survival relies upon sphingolipid homeostasis.

Authors - Yun-Chi Tang
  • KD Validated
humanWB

Nat Commun

Glycolysis regulates KRAS plasma membrane localization and function through defined glycosphingolipids

Authors - Junchen Liu
mouseWB

Nat Commun

Inhibition of glycosphingolipid synthesis with eliglustat in combination with immune checkpoint inhibitors in advanced cancers: preclinical evidence and phase I clinical trial

Authors - Liang Dong
  • KO Validated
rat,mouseIF

Nat Commun

Prosaposin maintains lipid homeostasis in dopamine neurons and counteracts experimental parkinsonism in rodents

Authors - Yachao He
mouseWB,IF

Cell Mol Biol Lett

UGCG modulates heart hypertrophy through B4GalT5-mediated mitochondrial oxidative stress and the ERK signaling pathway

Authors - Shengyu Cui
humanIF

Acta Pharmacol Sin

PXR ribosylation at E194 amplifies NAPQI in acetaminophen‒induced liver injury in mice, rescued by Schisandrin B.

Authors - Jia-Chan Long

Reviews

    4.5 out of 5
Add a review

2 verified customer reviews

What customers say

Both reviewers report positive experiences with this antibody. One user (5 stars) used it at a 1:1000 dilution for Western blot and found it performed well, planning to cite it in a forthcoming publication while also testing it for immunofluorescence. The other reviewer (4 stars) confirmed satisfactory results in Western blot and stated they would reorder. Overall, users find this antibody reliable and effective, particularly for WB applications.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Komuraiah (Verified Customer) (07-29-2025)

Ugcg (Rb) polyclonal antibody works great for western blot. WE will include in our forthcoming publication along with citation from this proteintech antibody. now we are also trying it for immunofluorescence.

  • Applications: Western Blot, Immunofluorescence, Immunoprecipitation, Cell culture
  • Primary Antibody Dilution: 1/1000

Will (Verified Customer) (01-31-2019)

good antibody, would order again

  • Applications: Western Blot,
Loading...
||
New chat

Able™

正在加载,请稍候...