Tested Applications
| Positive WB detected in | A375 cells, C6 cells, mouse brain tissue, U-251 cells |
| Positive IP detected in | A375 cells |
| Positive IHC detected in | human lung cancer tissue, human breast cancer tissue, human lymphoma tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse kidney tissue, mouse brain tissue |
| Positive IF-Fro detected in | mouse kidney tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)-FRO | IF-FRO : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
12869-1-AP targets UGCG in WB, IHC, IF-P, IF-Fro, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3530 Product name: Recombinant human UGCG protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 31-312 aa of BC038711 Sequence: IYTRLHLNKKATDKQPYSKLPGVSLLKPLKGVDPNLINNLETFFELDYPKYEVLLCVQDHDDPAIDVCKKLLGKYPNVDARLFIGGKKVGINPKINNLMPGYEVAKYDLIWICDSGIRVIPDTLTDMVNQMTEKVGLVHGLPYVADRQGFAATLEQVYFGTSHPRYYISANVTGFKCVTGMSCLMRKDVLDQAGGLIAFAQYIAEDYFMAKAIADRGWRFAMSTQVAMQNSGSYSISQFQSRMIRWTKLRINMLPATIICEPISECFVASLIIGWAAHHVFR Predict reactive species |
| Full Name | UDP-glucose ceramide glucosyltransferase |
| Calculated Molecular Weight | 394 aa, 45 kDa |
| Observed Molecular Weight | 50-55 kDa |
| GenBank Accession Number | BC038711 |
| Gene Symbol | UGCG |
| Gene ID (NCBI) | 7357 |
| RRID | AB_10915469 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q16739 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
UGCG, also named as GCS and GLCT-1, belongs to the glycosyltransferase 2 family. It catalyzes the first glycosylation step in glycosphingolipid biosynthesis, the transfer of glucose to ceramide. UGCG may also serve as a "flippase". It is up-regulated at the transcriptional level during keratinocyte differentiation. UGCG is a membrane protein. The calculated MW is 45 kDa. In SDS-PAGE, it is about 50-55 kDa.
Publications
What published studies show
The anti-UGCG antibody (Cat# 12869-1-AP) has 15 total citations published in journals including Nature Communications, Cancer Research, Acta Pharmacologica Sinica, PLoS Biology, Human Molecular Genetics, iScience, Scientific Reports, Frontiers in Pharmacology, International Journal of Biological Macromolecules, Cellular and Molecular Biology Letters, Aging, and International Journal of Molecular Sciences. Research fields span sphingolipid metabolism, cancer (breast, colon, NSCLC), liver fibrosis, neurodegeneration (ALS, Parkinson's), drug resistance, and viral infection.
| Species | Application | Title |
|---|---|---|
Nat Commun Glycolysis regulates KRAS plasma membrane localization and function through defined glycosphingolipids | ||
Nat Commun Inhibition of glycosphingolipid synthesis with eliglustat in combination with immune checkpoint inhibitors in advanced cancers: preclinical evidence and phase I clinical trial
| ||
Nat Commun Prosaposin maintains lipid homeostasis in dopamine neurons and counteracts experimental parkinsonism in rodents | ||
Cell Mol Biol Lett UGCG modulates heart hypertrophy through B4GalT5-mediated mitochondrial oxidative stress and the ERK signaling pathway | ||
Acta Pharmacol Sin PXR ribosylation at E194 amplifies NAPQI in acetaminophen‒induced liver injury in mice, rescued by Schisandrin B. |
Reviews
What customers say
Both reviewers report positive experiences with this antibody. One user (5 stars) used it at a 1:1000 dilution for Western blot and found it performed well, planning to cite it in a forthcoming publication while also testing it for immunofluorescence. The other reviewer (4 stars) confirmed satisfactory results in Western blot and stated they would reorder. Overall, users find this antibody reliable and effective, particularly for WB applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Komuraiah (Verified Customer) (07-29-2025) | Ugcg (Rb) polyclonal antibody works great for western blot. WE will include in our forthcoming publication along with citation from this proteintech antibody. now we are also trying it for immunofluorescence.
|
Will (Verified Customer) (01-31-2019) | good antibody, would order again
|
