• Featured Product
  • KD/KO Validated

UHRF1 Polyclonal antibody

UHRF1 Polyclonal Antibody for WB, IF/ICC, IP, ELISA
Cat No. 21402-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, IP, CoIP, RIP, ELISA

ICBP90, HuNp95, hUHRF1, hNp95, EC:2.3.2.27

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHuH-7 cells, HEK-293T cells, HeLa cells, MCF-7 cells
Positive IP detected inHeLa cells
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

21402-1-AP targets UHRF1 in WB, IHC, IF/ICC, IP, CoIP, RIP, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag16111

Product name: Recombinant human UHRF1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 88-392 aa of BC113875

Sequence: QSLVLPHSTKERDSELSDTDSGCCLGQSESDKSSTHGEAAAETDSRPADEDMWDETELGLYKVNEYVDARDTNMGAWFEAQVVRVTRKAPSRDEPCSSTSRPALEEDVIYHVKYDDYPENGVVQMNSRDVRARARTIIKWQDLEVGQVVMLNYNPDNPKERGFWYDAEISRKRETRTARELYANVVLGDDSLNDCRIIFVDEVFKIERPGEGSPMVDNPMRRKSGPSCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDECDMAFHIYCLDPPLSSVPSEDEWYCPECRNDASEVVLAGERLRE

Predict reactive species
Full Name ubiquitin-like with PHD and ring finger domains 1
Calculated Molecular Weight 806 aa, 91 kDa
Observed Molecular Weight 91-100 kDa
GenBank Accession NumberBC113875
Gene Symbol UHRF1
Gene ID (NCBI) 29128
RRIDAB_10860902
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ96T88
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

UHRF1, also named as ICBP90, NP95 and RNF106, is a putative E3 ubiquitin-protein ligase. It may participate in methylation-dependent transcriptional regulation. UHRF1 binds to inverted 5'-CCAAT-3' box 2 in the TOP2A promoter, and activates TOP2A expression. It is important for G1/S transition and may be involved in DNA repair and chromosomal stability. UHRF1's ability to repress its direct target gene expression is dependent on PHD(UHRF1) binding to unmodified H3R2. In addition, UHRF1 is a novel metabolic guardian restricting AMPK activity(PMID: 34907338).

Protocols

Product Specific Protocols
IF protocol for UHRF1 antibody 21402-1-APDownload protocol
IP protocol for UHRF1 antibody 21402-1-APDownload protocol
WB protocol for UHRF1 antibody 21402-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB,IF

Nucleic Acids Res

SET8 prevents excessive DNA methylation by methylation-mediated degradation of UHRF1 and DNMT1.

Authors - Huifang Zhang
humanWB

Theranostics

A feedforward circuit shaped by ECT2 and USP7 contributes to breast carcinogenesis.

Authors - Qi Zhang
humanWB

Cell Discov

USP7 negatively controls global DNA methylation by attenuating ubiquitinated histone-dependent DNMT1 recruitment.

Authors - Jialun Li
  • KD Validated
humanWB

Int J Mol Sci

Identification of Overexpressed Genes in Malignant Pleural Mesothelioma.

Authors - Federica Morani
mouseCoIP,RIP

Stem Cell Reports

UHRF1 interacts with snRNAs and regulates alternative splicing in mouse spermatogonial stem cells.

Authors - Shumin Zhou
WB,IHC

Inflammation

Upregulation of UHRF1 Promotes PINK1-mediated Mitophagy to Alleviates Ferroptosis in Diabetic Nephropathy

Authors - Hongfei Ji

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Leo (Verified Customer) (12-12-2024)

The antibody worked well for Western blot in mammalian cells.

  • Applications: Western Blot
Loading...
||
New chat Able
正在加载,请稍候...