Tested Applications
| Positive WB detected in | HepG2 cells, A549 cells, HAP1 cells, HEK-293 cells, mouse kidney tissue, rat kidney tissue |
| Positive IP detected in | HEK-293 cells |
| Positive IHC detected in | mouse kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below |
| WB | See 15 publications below |
| IHC | See 1 publications below |
| IF | See 6 publications below |
| IP | See 1 publications below |
| CoIP | See 2 publications below |
Product Information
10236-1-AP targets VPS35 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, monkey |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0340 Product name: Recombinant human VPS35 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-200 aa of BC002414 Sequence: MPTTQQSPQDEQEKLLDEAIQAVKVQSFQMKRCLDKNKLMDALKHASNMLGELRTSMLSPKSYYELYMAISDELHYLEVYLTDEFAKGRKVADLYELVQYAGNIIPRLYLLITVGVVYVKSFPQSRKDILKDLVEMCRGVQHPLRGLFLRNYLLQCTRNILPDEGEPTDEETTGDISDSMDFVLLNFAEMNKLWVRMQHQ Predict reactive species |
| Full Name | vacuolar protein sorting 35 homolog (S. cerevisiae) |
| Calculated Molecular Weight | 92 kDa |
| Observed Molecular Weight | 80-92 kDa |
| GenBank Accession Number | BC002414 |
| Gene Symbol | VPS35 |
| Gene ID (NCBI) | 55737 |
| RRID | AB_2215216 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q96QK1 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
VPS35 protein belongs to a group of vacuolar protein sorting (VPS) proteins, which ensure the proper delivery of organelle-specific proteins in eukaryotic cells. VPS35 is the core of a multimeric complex, termed the retromer complex, which is involved in retrograde transport of proteins from endosomes to the trans-Golgi network. Vps35 serves as the core of the multimeric complex by binding directly to Vps26 and Vps29 and SNX1. Northern blot analyses in 16 tissues showed that one transcript of Vps35 with a size of 3.6 kb was highly expressed in brain, heart, testis, ovary, small intestine, spleen, skeletal muscle, and placenta and expressed at moderate or low levels in other tissues. Another transcript of Vps35, a message of 3.0 kb, was also expressed with proportionally lower levels than the 3.6-kb transcript in all the tissues except that the 3.0-kb transcript was not detected in brain. Human Vps35 is mapped at 16q13-q21.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for VPS35 antibody 10236-1-AP | Download protocol |
| IHC protocol for VPS35 antibody 10236-1-AP | Download protocol |
| IP protocol for VPS35 antibody 10236-1-AP | Download protocol |
| WB protocol for VPS35 antibody 10236-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nat Commun A genome-wide CRISPR screen identifies host factors that regulate SARS-CoV-2 entry. | ||
Cell Death Differ Sorting nexin 3 induces heart failure via promoting retromer-dependent nuclear trafficking of STAT3. | ||
Proc Natl Acad Sci U S A SNX27 suppresses SARS-CoV-2 infection by inhibiting viral lysosome/late endosome entry. | ||
Hum Mol Genet VPS35 pathogenic mutations confer no dominant toxicity but partial loss of function in Drosophila and genetically interact with parkin. | ||
Am J Pathol Dynein Dysfunction Reproduces Age-Dependent Retromer Deficiency: Concomitant Disruption of Retrograde Trafficking Is Required for Alteration in β-Amyloid Precursor Protein Metabolism. | ||
J Neurochem Retromer and Rab2-dependent trafficking mediate PS1 degradation by proteasomes in endocytic disturbance.
|
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Xin (Verified Customer) (10-10-2022) | A very good antibody to detect endogenous VPS35 in mouse brain lysate.
![]() |
FH stephen (Verified Customer) (09-07-2019) | Oc-2 cells fixed with 4% PFA Perm. by 0.3% tx100 for 5 min blocked with 1% BSA in 1XPBS for 2 hours vps35 antibody incubated 1:300 overnight at 4 degrees in 1%BSA in 1x PBS. Co-stained with DAPI (blue) and Ph647 (red) to visualize DNA and F-actin respectively.
![]() |

















