Use Able AI chat for product recommendations

VWF, VWFpp Polyclonal antibody

VWF, VWFpp Polyclonal Antibody for WB, IP, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (2)

Applications

WB, IP, ELISA

F8VWF, von Willebrand antigen II, von Willebrand factor, VWD, VWF, VWF, VWFpp

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for VWF, VWFpp in ?

Tested Applications

Positive WB detected inHUVEC cells, Jurkat cells, human placenta tissue, mouse spleen tissue, rat spleen tissue
Positive IP detected inmouse spleen tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

11778-1-AP targets VWF, VWFpp in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig, monkey
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag2386

Product name: Recombinant human VWF, VWFpp protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-273 aa of .

Sequence: MGAQDEEEGIQDLDGLLVFDKIVEVTLLNLPWYNEETEGQRGEMTAPKSPRAKIRGTLCAEGTRGRSSTARCSLFGSDFVNTFDGSMYSFAGYCSYLLAGGCQKRSFSIIGDFQNGKRVSLSVYLGEFFDIHLFVNGTVTQGDQRVSMPYASKGLYLETEAGYYKLSGEAYGFVARIDGSGNFQVLLSDRYFNKTCGLCGNFNIFAEDDFMTQEGTLTSDPYDFANSWALSSGEQWCERASPPSSSCNISSGEMQKVGVDWPGCTWMVCDFWI

Predict reactive species
Full Name von Willebrand factor
Calculated Molecular Weight 309 kDa
Observed Molecular Weight 309-320 kDa, 75-100 kDa
GenBank Accession Number.
Gene Symbol VWF
Gene ID (NCBI) 7450
RRIDAB_10642840
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP04275
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Von Willebrand factor (vWF) is a large multimeric glycoprotein that is crucial to the hemostasis process. It supports platelet adhesion and carries factor VIII (FVIII). Deficiency of vWF results in von Willebrand disease (vWD), a common inherited bleeding disorder. The pre-pro-vWF is comprised of 2,813 amino acids (aa) which encompass a 22-aa signal peptide, a 741-aa large propeptide (vWF propeptide, vWFpp, also called von Willebrand antigen 2) and 2,050 aa making up the mature vWF. The von Willebrand antigen 2 is required for multimerization of vWF and for its targeting to storage granules. This antibody raised against the N-terminal region of pre-pro-vWF recognizes von Willebrand antigen 2 (75-100 kDa) and pro-vWF (309-320 kDa). (PMID: 9759493; 12067899; 22452980; 8874191)

Protocols

Product Specific Protocols
IP protocol for VWF, VWFpp antibody 11778-1-APDownload protocol
WB protocol for VWF, VWFpp antibody 11778-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The anti-VWF/VWFpp polyclonal antibody (Cat# 11778-1-AP) has accumulated 139 citations. Key journals include Nature Communications, Cell Metabolism, Circulation, Theranostics, Biomaterials, ACS Nano, and PNAS. Research fields encompass cardiovascular biology, angiogenesis, hemostasis and thrombosis, endothelial cell biology, tissue engineering, stem cell therapy, pulmonary hypertension, liver fibrosis, inflammation, and oncology. The antibody is predominantly applied in Western blot experiments across human, mouse, rat, pig, and monkey.

SpeciesApplicationTitle
pig

Circulation

Intramyocardial peptide nanofiber injection improves postinfarction ventricular remodeling and efficacy of bone marrow cell therapy in pigs.

Authors - Lin Yi-Dong YD
mouse

Circulation

Hyperglycemia inhibits cardiac stem cell-mediated cardiac repair and angiogenic capacity.

Authors - André S D Molgat
mouseWB

Cell Metab

Protein O-GlcNAcylation and hexokinase mitochondrial dissociation drive heart failure with preserved ejection fraction

Authors - Yuki Tatekoshi
mouse

Nat Commun

Small molecule BLVRB redox inhibitor promotes megakaryocytopoiesis and stress thrombopoiesis in vivo

Authors - Natasha M Nesbitt
WB

ACS Nano

Static Topographical Cue Combined with Dynamic Fluid Stimulation Enhances the Macrophage Extracellular Vesicle Yield and Therapeutic Potential for Bone Defects

Authors - Huayi Huang
mouse

Redox Biol

Nanoparticle endothelial delivery of PGC-1α attenuates hypoxia-induced pulmonary hypertension by attenuating EndoMT-caused vascular wall remodeling

Authors - Dunpeng Cai

Reviews

    4.0 out of 5
Add a review

1 verified customer reviews

What customers say

The product has one user review. A researcher used this antibody for immunofluorescence on HUVECs at a 1:50 dilution and rated it 4 out of 5 stars, describing it as a "good primary antibody." The review was submitted in September 2019 using a free sample lot. Overall, the feedback is positive, confirming reliable performance in IF applications on human endothelial cells.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Kim-Anh (Verified Customer) (09-03-2019)

Good primary antibody, I used for IF test on HUVECs

  • Applications: Immunofluorescence,
  • Primary Antibody Dilution: 1/50
  • Cell Tissue Type: huvecs
Loading...
||
New chat

Able™

正在加载,请稍候...