Tested Applications
| Positive WB detected in | HUVEC cells, Jurkat cells, human placenta tissue, mouse spleen tissue, rat spleen tissue |
| Positive IP detected in | mouse spleen tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
11778-1-AP targets VWF, VWFpp in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig, monkey |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2386 Product name: Recombinant human VWF, VWFpp protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-273 aa of . Sequence: MGAQDEEEGIQDLDGLLVFDKIVEVTLLNLPWYNEETEGQRGEMTAPKSPRAKIRGTLCAEGTRGRSSTARCSLFGSDFVNTFDGSMYSFAGYCSYLLAGGCQKRSFSIIGDFQNGKRVSLSVYLGEFFDIHLFVNGTVTQGDQRVSMPYASKGLYLETEAGYYKLSGEAYGFVARIDGSGNFQVLLSDRYFNKTCGLCGNFNIFAEDDFMTQEGTLTSDPYDFANSWALSSGEQWCERASPPSSSCNISSGEMQKVGVDWPGCTWMVCDFWI Predict reactive species |
| Full Name | von Willebrand factor |
| Calculated Molecular Weight | 309 kDa |
| Observed Molecular Weight | 309-320 kDa, 75-100 kDa |
| GenBank Accession Number | . |
| Gene Symbol | VWF |
| Gene ID (NCBI) | 7450 |
| RRID | AB_10642840 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P04275 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Von Willebrand factor (vWF) is a large multimeric glycoprotein that is crucial to the hemostasis process. It supports platelet adhesion and carries factor VIII (FVIII). Deficiency of vWF results in von Willebrand disease (vWD), a common inherited bleeding disorder. The pre-pro-vWF is comprised of 2,813 amino acids (aa) which encompass a 22-aa signal peptide, a 741-aa large propeptide (vWF propeptide, vWFpp, also called von Willebrand antigen 2) and 2,050 aa making up the mature vWF. The von Willebrand antigen 2 is required for multimerization of vWF and for its targeting to storage granules. This antibody raised against the N-terminal region of pre-pro-vWF recognizes von Willebrand antigen 2 (75-100 kDa) and pro-vWF (309-320 kDa). (PMID: 9759493; 12067899; 22452980; 8874191)
Protocols
| Product Specific Protocols | |
|---|---|
| IP protocol for VWF, VWFpp antibody 11778-1-AP | Download protocol |
| WB protocol for VWF, VWFpp antibody 11778-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The anti-VWF/VWFpp polyclonal antibody (Cat# 11778-1-AP) has accumulated 139 citations. Key journals include Nature Communications, Cell Metabolism, Circulation, Theranostics, Biomaterials, ACS Nano, and PNAS. Research fields encompass cardiovascular biology, angiogenesis, hemostasis and thrombosis, endothelial cell biology, tissue engineering, stem cell therapy, pulmonary hypertension, liver fibrosis, inflammation, and oncology. The antibody is predominantly applied in Western blot experiments across human, mouse, rat, pig, and monkey.
| Species | Application | Title |
|---|---|---|
Circulation Intramyocardial peptide nanofiber injection improves postinfarction ventricular remodeling and efficacy of bone marrow cell therapy in pigs. | ||
Circulation Hyperglycemia inhibits cardiac stem cell-mediated cardiac repair and angiogenic capacity. | ||
Cell Metab Protein O-GlcNAcylation and hexokinase mitochondrial dissociation drive heart failure with preserved ejection fraction | ||
Nat Commun Small molecule BLVRB redox inhibitor promotes megakaryocytopoiesis and stress thrombopoiesis in vivo | ||
ACS Nano Static Topographical Cue Combined with Dynamic Fluid Stimulation Enhances the Macrophage Extracellular Vesicle Yield and Therapeutic Potential for Bone Defects | ||
Redox Biol Nanoparticle endothelial delivery of PGC-1α attenuates hypoxia-induced pulmonary hypertension by attenuating EndoMT-caused vascular wall remodeling |
Reviews
What customers say
The product has one user review. A researcher used this antibody for immunofluorescence on HUVECs at a 1:50 dilution and rated it 4 out of 5 stars, describing it as a "good primary antibody." The review was submitted in September 2019 using a free sample lot. Overall, the feedback is positive, confirming reliable performance in IF applications on human endothelial cells.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Kim-Anh (Verified Customer) (09-03-2019) | Good primary antibody, I used for IF test on HUVECs
|
