SP6 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SP6 Polyclonal antibody (28561-1-AP)

• 

  WB analysis using 28561-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28561-1-AP (SP6 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human stomach cancer using 28561-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 28561-1-AP (SP6 antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 28561-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using SP6 antibody (28561-1-AP) at dilution of 1:600 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-Phalloidin (red).

SP6 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 28561-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

AI1K, EPFN, EPIPROFIN, KLF14, Krueppel-like factor 14

---

Tested Applications

• Positive WB detected in: L02 cells, MCF-7 cells
• Positive IHC detected in: human stomach cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:200-1:800
• Immunofluorescence (IF)/ICC: IF/ICC : 1:300-1:1200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

28561-1-AP targets SP6 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29372

  Product name: Recombinant human SP6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 186-376 aa of BC103951

  Sequence: PDGAKALEVAAPESQGLDSSLDGAARPKGSRRSVPRSSGQTVCRCPNCLEAERLGAPCGPDGGKKKHLHNCHIPGCGKAYAKTSHLKAHLRWHSGDRPFVCNWLFCGKRFTRSDELQRHLQTHTGTKKFPCAVCSRVFMRSDHLAKHMKTHEGAKEEAAGAASGEGKAGGAVEPPGGKGKREAEGSVAPSN

• Full Name: Sp6 transcription factor
• Calculated Molecular Weight: 376 aa, 40 kDa
• Observed Molecular Weight: 40-44 kDa
• GenBank Accession Number: BC103951
• Gene Symbol: SP6
• Gene ID (NCBI): 80320
• RRID: AB_3669661
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q3SY56
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SP6 (also known as Epfn) is a C2H2-type zinc-finger transcription factor located at 17q21.32, which functions as a transcriptional activator and plays essential roles in odontogenesis and cell proliferation. Notably, this gene has also been referred to as KLF14 in earlier literature, particularly in the context of its discovery as a member of the SP/XKLF transcription factor family. However, it is critical to distinguish this 17q21.32 SP6/KLF14 from the distinct KLF14 gene located at 7q32.2 (official symbol KLF14, also known as BTEB5), which is an intronless gene encoding a transcriptional co-repressor that exhibits maternal imprinting and is primarily associated with metabolic regulation, including type 2 diabetes and lipid homeostasis, as well as roles in cancer and fibrosis. Despite sharing the "KLF14" alias and structural homology within their zinc-finger DNA-binding domains, these two genes reside at separate chromosomal loci, possess divergent transcriptional activities (activator versus repressor), and govern distinct physiological processes.